BLASTX nr result
ID: Astragalus23_contig00020699
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00020699 (324 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007139167.1| hypothetical protein PHAVU_008G007000g [Phas... 56 4e-08 >ref|XP_007139167.1| hypothetical protein PHAVU_008G007000g [Phaseolus vulgaris] gb|ESW11161.1| hypothetical protein PHAVU_008G007000g [Phaseolus vulgaris] Length = 69 Score = 55.8 bits (133), Expect = 4e-08 Identities = 28/56 (50%), Positives = 36/56 (64%) Frame = +3 Query: 54 VCIKRGIVMEKRCVKVIDKNGIIEAHAMGHKMTGNCSFHVPCFVFGMVPLPLLLFF 221 VCI + ++ VKV+DKN I++AH +GHKMTGNC FH PLP+ LFF Sbjct: 2 VCIMKTKWYKEMRVKVMDKNDIMQAHVLGHKMTGNCCFH-------GCPLPVYLFF 50