BLASTX nr result
ID: Astragalus23_contig00020201
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00020201 (314 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU20895.1| hypothetical protein TSUD_120870, partial [Trifo... 56 7e-07 gb|PNX65551.1| hypothetical protein L195_g054593, partial [Trifo... 52 7e-07 >dbj|GAU20895.1| hypothetical protein TSUD_120870, partial [Trifolium subterraneum] Length = 557 Score = 56.2 bits (134), Expect = 7e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -2 Query: 103 ITVYSLD*NCTDSMGTEFETIEGRITSMLPQLQ 5 I V LD NC DSMGTEFET+EGRITSMLPQLQ Sbjct: 150 IIVLPLDLNCKDSMGTEFETVEGRITSMLPQLQ 182 >gb|PNX65551.1| hypothetical protein L195_g054593, partial [Trifolium pratense] Length = 66 Score = 52.4 bits (124), Expect = 7e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -2 Query: 103 ITVYSLD*NCTDSMGTEFETIEGRITSMLPQLQ 5 I V LD +C DSMGTEFET+EGRI SMLPQLQ Sbjct: 1 IIVLRLDLSCKDSMGTEFETVEGRINSMLPQLQ 33