BLASTX nr result
ID: Astragalus23_contig00020172
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00020172 (1095 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN08511.1| 40S ribosomal protein S6 [Glycine soja] 63 6e-07 >gb|KHN08511.1| 40S ribosomal protein S6 [Glycine soja] Length = 928 Score = 62.8 bits (151), Expect = 6e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 999 RDPRSYFEMKFNVANPTTGCQKKLEIDDDLKL 1094 RDP++ F+MKFN+ANPTTGCQKKLEIDDDLKL Sbjct: 672 RDPKADFKMKFNIANPTTGCQKKLEIDDDLKL 703