BLASTX nr result
ID: Astragalus23_contig00020040
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00020040 (302 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020203889.1| peroxidase 15-like [Cajanus cajan] 55 1e-06 >ref|XP_020203889.1| peroxidase 15-like [Cajanus cajan] Length = 354 Score = 55.1 bits (131), Expect = 1e-06 Identities = 30/43 (69%), Positives = 33/43 (76%), Gaps = 6/43 (13%) Frame = -2 Query: 301 DVLTGGQGEIRKQCNFVNKRSVEQDIATV------VEGIFSSI 191 DVLTG +GEIRK CNFVNK+SVE DIATV VEG+ SSI Sbjct: 312 DVLTGKKGEIRKHCNFVNKKSVELDIATVASQDSSVEGMVSSI 354