BLASTX nr result
ID: Astragalus23_contig00019744
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00019744 (1091 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017418444.1| PREDICTED: transportin MOS14 isoform X1 [Vig... 60 4e-06 >ref|XP_017418444.1| PREDICTED: transportin MOS14 isoform X1 [Vigna angularis] dbj|BAT84882.1| hypothetical protein VIGAN_04235100 [Vigna angularis var. angularis] Length = 1030 Score = 60.5 bits (145), Expect = 4e-06 Identities = 32/63 (50%), Positives = 39/63 (61%) Frame = +2 Query: 842 QLLSHAPMVLEFLLQQSEINYGGSGQQNEGTRKF**WLIRFLQFCHGSSF*SCSIISMVV 1021 +LLSH PMVLEFLLQQSEIN+ GS QQ E RK L+ +++ C SF C Sbjct: 180 ELLSHTPMVLEFLLQQSEINFDGSVQQQERNRKILRCLLSWVRHCSDDSFGFCIFSVKAG 239 Query: 1022 CFT 1030 CF+ Sbjct: 240 CFS 242