BLASTX nr result
ID: Astragalus23_contig00019623
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00019623 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU44088.1| hypothetical protein TSUD_399700 [Trifolium subt... 71 2e-11 gb|PNX99224.1| pentatricopeptide repeat-containing protein chlor... 70 8e-11 ref|XP_013468345.1| PPR containing plant-like protein [Medicago ... 69 2e-10 gb|KYP74104.1| hypothetical protein KK1_006772 [Cajanus cajan] 64 1e-08 ref|XP_020237287.1| pentatricopeptide repeat-containing protein ... 64 1e-08 ref|XP_004495010.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-08 gb|KHN05921.1| Pentatricopeptide repeat-containing protein, chlo... 63 2e-08 gb|KRH32307.1| hypothetical protein GLYMA_10G043900 [Glycine max] 63 2e-08 gb|KHN48987.1| Pentatricopeptide repeat-containing protein, chlo... 62 4e-08 ref|XP_003542463.1| PREDICTED: pentatricopeptide repeat-containi... 62 4e-08 ref|XP_016179856.1| pentatricopeptide repeat-containing protein ... 61 9e-08 ref|XP_015947797.1| pentatricopeptide repeat-containing protein ... 61 9e-08 gb|AFK41438.1| unknown [Lotus japonicus] 57 2e-07 ref|XP_009374668.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 gb|PON37469.1| Tetratricopeptide-like helical domain containing ... 59 4e-07 ref|XP_008350429.1| PREDICTED: pentatricopeptide repeat-containi... 58 5e-07 ref|XP_012074894.1| pentatricopeptide repeat-containing protein ... 59 6e-07 ref|XP_007144456.1| hypothetical protein PHAVU_007G157700g [Phas... 58 8e-07 ref|XP_010111773.1| pentatricopeptide repeat-containing protein ... 58 8e-07 gb|POO02408.1| Tetratricopeptide-like helical domain containing ... 58 1e-06 >dbj|GAU44088.1| hypothetical protein TSUD_399700 [Trifolium subterraneum] Length = 632 Score = 71.2 bits (173), Expect = 2e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQKPRRF 116 K+SERE SMIRGFLKIRKFNDALANLGGILDRQ PRR+ Sbjct: 595 KMSERETSMIRGFLKIRKFNDALANLGGILDRQNPRRY 632 >gb|PNX99224.1| pentatricopeptide repeat-containing protein chloroplastic-like [Trifolium pratense] Length = 731 Score = 69.7 bits (169), Expect = 8e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQKPRRF 116 K+SERE S+IRGFLKIRKFNDALANLGGILDRQ PRR+ Sbjct: 694 KMSERETSIIRGFLKIRKFNDALANLGGILDRQNPRRY 731 >ref|XP_013468345.1| PPR containing plant-like protein [Medicago truncatula] gb|KEH42382.1| PPR containing plant-like protein [Medicago truncatula] Length = 727 Score = 68.6 bits (166), Expect = 2e-10 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQKPRRF 116 ++SERE SMIRGFLKIRKFNDALANLGGILDRQ P+R+ Sbjct: 689 QMSERETSMIRGFLKIRKFNDALANLGGILDRQNPKRY 726 >gb|KYP74104.1| hypothetical protein KK1_006772 [Cajanus cajan] Length = 638 Score = 63.5 bits (153), Expect = 1e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQKPRRF 116 + S+ E S+IRGFLKIRKFNDALANL GILDR+KPRRF Sbjct: 601 RFSQAETSIIRGFLKIRKFNDALANLAGILDRKKPRRF 638 >ref|XP_020237287.1| pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Cajanus cajan] Length = 755 Score = 63.5 bits (153), Expect = 1e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQKPRRF 116 + S+ E S+IRGFLKIRKFNDALANL GILDR+KPRRF Sbjct: 718 RFSQAETSIIRGFLKIRKFNDALANLAGILDRKKPRRF 755 >ref|XP_004495010.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Cicer arietinum] Length = 714 Score = 63.2 bits (152), Expect = 1e-08 Identities = 32/39 (82%), Positives = 35/39 (89%), Gaps = 1/39 (2%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDR-QKPRRF 116 K+S+RE SMIRGFLKIRKF DALANLGGILDR KPRR+ Sbjct: 676 KMSDRETSMIRGFLKIRKFGDALANLGGILDRHNKPRRY 714 >gb|KHN05921.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 603 Score = 62.8 bits (151), Expect = 2e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQKPRRF 116 K+S+ E S+IRGFLKI+KFNDALANLG ILDR++PRRF Sbjct: 566 KLSQAETSIIRGFLKIQKFNDALANLGAILDRKRPRRF 603 >gb|KRH32307.1| hypothetical protein GLYMA_10G043900 [Glycine max] Length = 734 Score = 62.8 bits (151), Expect = 2e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQKPRRF 116 K+S+ E S+IRGFLKI+KFNDALANLG ILDR++PRRF Sbjct: 697 KLSQAETSIIRGFLKIQKFNDALANLGAILDRKRPRRF 734 >gb|KHN48987.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 603 Score = 62.0 bits (149), Expect = 4e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQKPRRF 116 + S+ E S+IRGFLKI+KFNDALANLG ILDR+KPRRF Sbjct: 566 RFSQSETSIIRGFLKIQKFNDALANLGAILDRKKPRRF 603 >ref|XP_003542463.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Glycine max] gb|KRH19713.1| hypothetical protein GLYMA_13G131600 [Glycine max] Length = 756 Score = 62.0 bits (149), Expect = 4e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQKPRRF 116 + S+ E S+IRGFLKI+KFNDALANLG ILDR+KPRRF Sbjct: 719 RFSQSETSIIRGFLKIQKFNDALANLGAILDRKKPRRF 756 >ref|XP_016179856.1| pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Arachis ipaensis] ref|XP_016179863.1| pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Arachis ipaensis] Length = 764 Score = 60.8 bits (146), Expect = 9e-08 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 1/39 (2%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQ-KPRRF 116 K+S+ E SMIRGFLKI+KF+DALANLGGIL+RQ KPRRF Sbjct: 726 KLSQGETSMIRGFLKIQKFSDALANLGGILERQNKPRRF 764 >ref|XP_015947797.1| pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Arachis duranensis] ref|XP_015947798.1| pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Arachis duranensis] Length = 767 Score = 60.8 bits (146), Expect = 9e-08 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 1/39 (2%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQ-KPRRF 116 K+S+ E SMIRGFLKI+KF+DALANLGGIL+RQ KPRRF Sbjct: 729 KLSQGEASMIRGFLKIQKFSDALANLGGILERQNKPRRF 767 >gb|AFK41438.1| unknown [Lotus japonicus] Length = 114 Score = 57.0 bits (136), Expect = 2e-07 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQKPRRF 116 K SE E SMIRGFLKI KF DALANL ILDRQK RR+ Sbjct: 77 KFSEMETSMIRGFLKINKFKDALANLSVILDRQKSRRY 114 >ref|XP_009374668.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Pyrus x bretschneideri] Length = 775 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQKPRR 113 K+S+ E+SMI GFLKIRK+ DALANLGGIL+R+KPR+ Sbjct: 734 KLSDSEVSMISGFLKIRKYQDALANLGGILNREKPRK 770 >gb|PON37469.1| Tetratricopeptide-like helical domain containing protein [Parasponia andersonii] Length = 758 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQKPRR 113 K+S+ E+SMIRGFLKIRKF+DALA LGGILD +KP + Sbjct: 715 KLSDSEVSMIRGFLKIRKFHDALATLGGILDSRKPNK 751 >ref|XP_008350429.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Malus domestica] Length = 258 Score = 58.2 bits (139), Expect = 5e-07 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = +3 Query: 6 VSEREISMIRGFLKIRKFNDALANLGGILDRQKPRR 113 +S+ E+SMI GFLKIRK+ DALANLGGIL+R+KPR+ Sbjct: 218 LSDSEVSMISGFLKIRKYQDALANLGGILNREKPRK 253 >ref|XP_012074894.1| pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Jatropha curcas] gb|KDP35601.1| hypothetical protein JCGZ_09039 [Jatropha curcas] Length = 759 Score = 58.5 bits (140), Expect = 6e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +3 Query: 9 SEREISMIRGFLKIRKFNDALANLGGILDRQKPRR 113 SE E++MIRGF+KIRKF DALA LGGILDR+KP++ Sbjct: 722 SENEVTMIRGFVKIRKFQDALATLGGILDRRKPKK 756 >ref|XP_007144456.1| hypothetical protein PHAVU_007G157700g [Phaseolus vulgaris] gb|ESW16450.1| hypothetical protein PHAVU_007G157700g [Phaseolus vulgaris] Length = 755 Score = 58.2 bits (139), Expect = 8e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQKPRRF 116 + S E S+++GFLKI+KFNDALANLG ILDR++PRRF Sbjct: 718 RFSPSETSIVKGFLKIQKFNDALANLGAILDRKRPRRF 755 >ref|XP_010111773.1| pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Morus notabilis] ref|XP_024031415.1| pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Morus notabilis] gb|EXC31687.1| hypothetical protein L484_008777 [Morus notabilis] Length = 781 Score = 58.2 bits (139), Expect = 8e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQKPRR 113 K S+ E+SMIRGFLKIRKF DALANLGGIL+ + PRR Sbjct: 737 KFSDSEVSMIRGFLKIRKFPDALANLGGILNSRTPRR 773 >gb|POO02408.1| Tetratricopeptide-like helical domain containing protein [Trema orientalis] Length = 762 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +3 Query: 3 KVSEREISMIRGFLKIRKFNDALANLGGILDRQKPRR 113 K+S+ E+SMI+GFLKIRKF+DALA LGGILD +KP + Sbjct: 719 KLSDSEVSMIKGFLKIRKFHDALATLGGILDSRKPNK 755