BLASTX nr result

ID: Astragalus23_contig00019578 seq

BLASTX 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Astragalus23_contig00019578
         (440 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           149,584,005 sequences; 54,822,741,787 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb|PAC32344.1| hypothetical protein CE425_25025 [Salmonella ente...   140   6e-41
gb|ORD31627.1| hypothetical protein A4T40_04410 [Escherichia col...   135   9e-39
gb|ORC94772.1| hypothetical protein A4T35_22435 [Escherichia coli]    132   8e-38
gb|ORD85017.1| hypothetical protein A4T54_07395 [Escherichia coli]    130   9e-37
gb|KMG76845.1| hypothetical protein SM55_04735, partial [Klebsie...   119   1e-32
gb|PLC65554.1| hypothetical protein B9P82_07320 [Citrobacter sp....   117   8e-32
gb|PLC65555.1| hypothetical protein B9P82_07325 [Citrobacter sp....   117   8e-32
gb|ATI08916.1| hypothetical protein CO715_25010 [Escherichia col...   112   5e-30
emb|CDG89398.1| conserved hypothetical protein [Xenorhabdus bovi...   102   9e-26
gb|OUI24147.1| hypothetical protein AZZ71_002872, partial [Klebs...   100   2e-25
gb|OOE39093.1| hypothetical protein BZG06_15915 [Salinivibrio ku...    96   2e-23
gb|ABU75356.1| hypothetical protein ESA_00050 [Cronobacter sakaz...    86   8e-20
gb|KEJ23865.1| hypothetical protein AB03_3268 [Escherichia coli ...    85   2e-19
gb|EKI55767.1| hypothetical protein ECN1_0191, partial [Escheric...    85   3e-19
gb|EDU30654.1| conserved hypothetical protein [Escherichia coli ...    85   3e-19
gb|KLW05272.1| hypothetical protein SK45_03630, partial [Enterob...    85   3e-19
gb|EQR69632.1| hypothetical protein G790_00051, partial [Escheri...    85   3e-19
gb|ELI34475.1| hypothetical protein WII_04366, partial [Escheric...    85   3e-19
gb|KEM89333.1| hypothetical protein AC92_3539 [Escherichia coli ...    85   3e-19
gb|OUF02898.1| hypothetical protein AZZ94_003440, partial [Enter...    85   3e-19

>gb|PAC32344.1| hypothetical protein CE425_25025 [Salmonella enterica subsp.
           enterica serovar Senftenberg]
          Length = 68

 Score =  140 bits (353), Expect = 6e-41
 Identities = 65/68 (95%), Positives = 66/68 (97%)
 Frame = +3

Query: 183 VSVWGTI*CYLMLRGFSWKQGICCFSTVVPRHHASALIFRICLENQPTRLNRDNRRPANI 362
           +SVWGTI CYLMLRGFSWKQGICCFSTVVPR HASALIFRICLENQPTRLNRDNRRPANI
Sbjct: 1   MSVWGTISCYLMLRGFSWKQGICCFSTVVPRRHASALIFRICLENQPTRLNRDNRRPANI 60

Query: 363 AFSVPPSQ 386
           AFSVPPSQ
Sbjct: 61  AFSVPPSQ 68


>gb|ORD31627.1| hypothetical protein A4T40_04410 [Escherichia coli]
 gb|PDO00353.1| hypothetical protein CJU68_14385 [Escherichia coli]
          Length = 75

 Score =  135 bits (339), Expect = 9e-39
 Identities = 63/64 (98%), Positives = 64/64 (100%)
 Frame = +2

Query: 248 LLLQHRSASSSRLSLDFPDLPGKPAYTLKPGQPSPGQHSLLRPPFAVTPSTGILTCFPST 427
           +LLQHRSASSSRLSLDFPDLPGKPAYTLKPGQPSPGQHSLLRPPFAVTPSTGILTCFPST
Sbjct: 1   MLLQHRSASSSRLSLDFPDLPGKPAYTLKPGQPSPGQHSLLRPPFAVTPSTGILTCFPST 60

Query: 428 TPFG 439
           TPFG
Sbjct: 61  TPFG 64


>gb|ORC94772.1| hypothetical protein A4T35_22435 [Escherichia coli]
          Length = 75

 Score =  132 bits (333), Expect = 8e-38
 Identities = 62/62 (100%), Positives = 62/62 (100%)
 Frame = +2

Query: 254 LQHRSASSSRLSLDFPDLPGKPAYTLKPGQPSPGQHSLLRPPFAVTPSTGILTCFPSTTP 433
           LQHRSASSSRLSLDFPDLPGKPAYTLKPGQPSPGQHSLLRPPFAVTPSTGILTCFPSTTP
Sbjct: 3   LQHRSASSSRLSLDFPDLPGKPAYTLKPGQPSPGQHSLLRPPFAVTPSTGILTCFPSTTP 62

Query: 434 FG 439
           FG
Sbjct: 63  FG 64


>gb|ORD85017.1| hypothetical protein A4T54_07395 [Escherichia coli]
          Length = 75

 Score =  130 bits (326), Expect = 9e-37
 Identities = 61/62 (98%), Positives = 61/62 (98%)
 Frame = +2

Query: 254 LQHRSASSSRLSLDFPDLPGKPAYTLKPGQPSPGQHSLLRPPFAVTPSTGILTCFPSTTP 433
           LQHRSASSSRLSL FPDLPGKPAYTLKPGQPSPGQHSLLRPPFAVTPSTGILTCFPSTTP
Sbjct: 3   LQHRSASSSRLSLGFPDLPGKPAYTLKPGQPSPGQHSLLRPPFAVTPSTGILTCFPSTTP 62

Query: 434 FG 439
           FG
Sbjct: 63  FG 64


>gb|KMG76845.1| hypothetical protein SM55_04735, partial [Klebsiella pneumoniae]
          Length = 60

 Score =  119 bits (298), Expect = 1e-32
 Identities = 55/60 (91%), Positives = 56/60 (93%)
 Frame = +3

Query: 207 CYLMLRGFSWKQGICCFSTVVPRHHASALIFRICLENQPTRLNRDNRRPANIAFSVPPSQ 386
           CYLMLRGFSWKQGIC FSTVVPRHH SALI RICL+NQPT LNRDNRRPANIAFSVPPSQ
Sbjct: 1   CYLMLRGFSWKQGICYFSTVVPRHHTSALIIRICLDNQPTCLNRDNRRPANIAFSVPPSQ 60


>gb|PLC65554.1| hypothetical protein B9P82_07320 [Citrobacter sp. L55]
          Length = 69

 Score =  117 bits (293), Expect = 8e-32
 Identities = 58/69 (84%), Positives = 60/69 (86%), Gaps = 1/69 (1%)
 Frame = +3

Query: 183 VSVWGTI*CYLMLRGFSWKQGICCFSTVVPRHHASALI-FRICLENQPTRLNRDNRRPAN 359
           +SVWGTI CYLMLRGFSWKQGIC FSTVVPRHH SAL   RI LE+ PT LNRDNRRPAN
Sbjct: 1   MSVWGTILCYLMLRGFSWKQGICYFSTVVPRHHTSALTRLRIYLESPPTCLNRDNRRPAN 60

Query: 360 IAFSVPPSQ 386
           IAFSVPPSQ
Sbjct: 61  IAFSVPPSQ 69


>gb|PLC65555.1| hypothetical protein B9P82_07325 [Citrobacter sp. L55]
          Length = 69

 Score =  117 bits (293), Expect = 8e-32
 Identities = 58/69 (84%), Positives = 60/69 (86%), Gaps = 1/69 (1%)
 Frame = +3

Query: 183 VSVWGTI*CYLMLRGFSWKQGICCFSTVVPRHHASALI-FRICLENQPTRLNRDNRRPAN 359
           +SVWGTI CYLMLRGFSWKQGIC FSTVVPRHH SAL   RI LE+ PT LNRDNRRPAN
Sbjct: 1   MSVWGTILCYLMLRGFSWKQGICYFSTVVPRHHTSALARLRIYLESPPTCLNRDNRRPAN 60

Query: 360 IAFSVPPSQ 386
           IAFSVPPSQ
Sbjct: 61  IAFSVPPSQ 69


>gb|ATI08916.1| hypothetical protein CO715_25010 [Escherichia coli M12]
          Length = 65

 Score =  112 bits (281), Expect = 5e-30
 Identities = 53/55 (96%), Positives = 54/55 (98%)
 Frame = +2

Query: 251 LLQHRSASSSRLSLDFPDLPGKPAYTLKPGQPSPGQHSLLRPPFAVTPSTGILTC 415
           +LQHRSASSSRLSLDFPDLPGK AYTLKPGQPSPGQHSLLRPPFAVTPSTGILTC
Sbjct: 1   MLQHRSASSSRLSLDFPDLPGKSAYTLKPGQPSPGQHSLLRPPFAVTPSTGILTC 55


>emb|CDG89398.1| conserved hypothetical protein [Xenorhabdus bovienii str. feltiae
           France]
 emb|CDG93633.1| conserved hypothetical protein [Xenorhabdus bovienii str. feltiae
           Florida]
          Length = 69

 Score =  102 bits (253), Expect = 9e-26
 Identities = 53/69 (76%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query: 183 VSVWGTI*CYLMLRGFSWKQGICCFSTVVPRHHASALI-FRICLENQPTRLNRDNRRPAN 359
           +SVWGTI CYLMLRGFSWKQGI  FSTVVPR+HAS L   RI     PTRLNRDNRRPA 
Sbjct: 1   MSVWGTIHCYLMLRGFSWKQGINHFSTVVPRYHASVLTEERIYQFFPPTRLNRDNRRPAG 60

Query: 360 IAFSVPPSQ 386
           +AFSVPPSQ
Sbjct: 61  LAFSVPPSQ 69


>gb|OUI24147.1| hypothetical protein AZZ71_002872, partial [Klebsiella pneumoniae]
          Length = 52

 Score =  100 bits (250), Expect = 2e-25
 Identities = 46/52 (88%), Positives = 48/52 (92%)
 Frame = +3

Query: 216 MLRGFSWKQGICCFSTVVPRHHASALIFRICLENQPTRLNRDNRRPANIAFS 371
           MLRGFSWKQGIC FSTVVPRHH SAL+ RICL+NQPT LNRDNRRPANIAFS
Sbjct: 1   MLRGFSWKQGICYFSTVVPRHHTSALVIRICLDNQPTCLNRDNRRPANIAFS 52


>gb|OOE39093.1| hypothetical protein BZG06_15915 [Salinivibrio kushneri]
          Length = 76

 Score = 96.3 bits (238), Expect = 2e-23
 Identities = 48/75 (64%), Positives = 54/75 (72%)
 Frame = +3

Query: 162 LISAPXPVSVWGTI*CYLMLRGFSWKQGICCFSTVVPRHHASALIFRICLENQPTRLNRD 341
           + S   PVSVW T+  YL LRGFS K GI  F+T+V RH  SALI RICL NQPT LN D
Sbjct: 2   VFSTRPPVSVWSTVPTYLKLRGFSRKHGINXFTTLVARHRVSALISRICLRNQPTHLNLD 61

Query: 342 NRRPANIAFSVPPSQ 386
           N R A++AFSVPPSQ
Sbjct: 62  NHRQAHLAFSVPPSQ 76


>gb|ABU75356.1| hypothetical protein ESA_00050 [Cronobacter sakazakii ATCC BAA-894]
 gb|ABU75946.1| hypothetical protein ESA_00666 [Cronobacter sakazakii ATCC BAA-894]
 gb|ABU78360.1| hypothetical protein ESA_03135 [Cronobacter sakazakii ATCC BAA-894]
 gb|ABU78873.1| hypothetical protein ESA_03667 [Cronobacter sakazakii ATCC BAA-894]
 gb|ABU78906.1| hypothetical protein ESA_03707 [Cronobacter sakazakii ATCC BAA-894]
 gb|ABU78984.1| hypothetical protein ESA_03795 [Cronobacter sakazakii ATCC BAA-894]
          Length = 44

 Score = 86.3 bits (212), Expect = 8e-20
 Identities = 41/44 (93%), Positives = 42/44 (95%)
 Frame = -3

Query: 192 KPTQVXELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 61
           KP +V ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG
Sbjct: 2   KPLRV-ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 44


>gb|KEJ23865.1| hypothetical protein AB03_3268 [Escherichia coli 2-316-03_S1_C1]
          Length = 42

 Score = 85.1 bits (209), Expect = 2e-19
 Identities = 38/41 (92%), Positives = 40/41 (97%)
 Frame = -3

Query: 183 QVXELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 61
           ++ ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG
Sbjct: 2   KLLELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 42


>gb|EKI55767.1| hypothetical protein ECN1_0191, partial [Escherichia coli N1]
 gb|EKK49607.1| hypothetical protein EC80566_0198, partial [Escherichia coli
           8.0566]
 gb|EKY88019.1| hypothetical protein C212_04120, partial [Escherichia coli O104:H4
           str. 11-02030]
 gb|EKY89274.1| hypothetical protein C213_04122, partial [Escherichia coli O104:H4
           str. 11-02033-1]
 gb|EKY89469.1| hypothetical protein C214_04108, partial [Escherichia coli O104:H4
           str. 11-02092]
 gb|EKY91545.1| hypothetical protein C212_03293, partial [Escherichia coli O104:H4
           str. 11-02030]
 gb|EKY92279.1| hypothetical protein C213_03294, partial [Escherichia coli O104:H4
           str. 11-02033-1]
 gb|EKY93099.1| hypothetical protein C214_03284, partial [Escherichia coli O104:H4
           str. 11-02092]
 gb|EKZ03274.1| hypothetical protein C215_04087, partial [Escherichia coli O104:H4
           str. 11-02093]
 gb|EKZ04176.1| hypothetical protein C216_04123, partial [Escherichia coli O104:H4
           str. 11-02281]
 gb|EKZ06645.1| hypothetical protein C217_04115, partial [Escherichia coli O104:H4
           str. 11-02318]
 gb|EKZ07156.1| hypothetical protein C215_03265, partial [Escherichia coli O104:H4
           str. 11-02093]
 gb|EKZ07612.1| hypothetical protein C216_03292, partial [Escherichia coli O104:H4
           str. 11-02281]
 gb|EKZ11812.1| hypothetical protein C217_03289, partial [Escherichia coli O104:H4
           str. 11-02318]
 gb|EKZ18930.1| hypothetical protein C218_04121, partial [Escherichia coli O104:H4
           str. 11-02913]
 gb|EKZ21153.1| hypothetical protein C221_04116, partial [Escherichia coli O104:H4
           str. 11-03943]
 gb|EKZ21675.1| hypothetical protein C219_04125, partial [Escherichia coli O104:H4
           str. 11-03439]
 gb|EKZ23159.1| hypothetical protein C218_03292, partial [Escherichia coli O104:H4
           str. 11-02913]
 gb|EKZ25512.1| hypothetical protein C219_03296, partial [Escherichia coli O104:H4
           str. 11-03439]
 gb|EKZ26614.1| hypothetical protein C221_03287, partial [Escherichia coli O104:H4
           str. 11-03943]
 gb|EKZ33262.1| hypothetical protein C220_04115, partial [Escherichia coli O104:H4
           str. 11-04080]
 gb|EKZ36078.1| hypothetical protein C220_03291, partial [Escherichia coli O104:H4
           str. 11-04080]
 gb|EKZ48302.1| hypothetical protein O7G_04562, partial [Escherichia coli O104:H4
           str. Ec11-4986]
 gb|EKZ48671.1| hypothetical protein O7C_03056, partial [Escherichia coli O104:H4
           str. Ec11-4984]
 gb|EKZ76856.1| hypothetical protein S7Y_00516, partial [Escherichia coli O104:H4
           str. Ec12-0465]
 gb|EKZ78201.1| hypothetical protein S7Y_04722, partial [Escherichia coli O104:H4
           str. Ec12-0465]
 gb|EKZ86654.1| hypothetical protein S91_03838, partial [Escherichia coli O104:H4
           str. Ec12-0466]
 gb|EKZ92097.1| hypothetical protein MO7_05179, partial [Escherichia coli O104:H4
           str. Ec11-9941]
 gb|EKZ94218.1| hypothetical protein MO7_05259, partial [Escherichia coli O104:H4
           str. Ec11-9941]
 gb|ELD06801.1| hypothetical protein A15K_04185, partial [Escherichia coli KTE205]
 gb|ELJ79568.1| hypothetical protein WGY_04182, partial [Escherichia coli KTE95]
 gb|EQR82218.1| hypothetical protein G791_02805, partial [Escherichia coli HVH 133
           (4-4466519)]
 gb|EQT33174.1| hypothetical protein G834_04030, partial [Escherichia coli HVH 182
           (4-0985554)]
 gb|EQZ98340.1| hypothetical protein G994_03493, partial [Escherichia coli UMEA
           3718-1]
 gb|EYE31925.1| hypothetical protein AB10_4613, partial [Escherichia coli
           1-110-08_S1_C1]
 gb|EYE31932.1| hypothetical protein AB10_4609, partial [Escherichia coli
           1-110-08_S1_C1]
 gb|EYE32023.1| hypothetical protein AB10_4440, partial [Escherichia coli
           1-110-08_S1_C1]
 gb|EYE32190.1| hypothetical protein AB10_4347, partial [Escherichia coli
           1-110-08_S1_C1]
 gb|EYE40721.1| hypothetical protein AB10_0208, partial [Escherichia coli
           1-110-08_S1_C1]
 gb|EZK16694.1| hypothetical protein AB26_4456, partial [Escherichia coli
           2-011-08_S1_C2]
 gb|EZK17283.1| hypothetical protein AB26_4322, partial [Escherichia coli
           2-011-08_S1_C2]
 gb|EZK26866.1| hypothetical protein AB26_0197, partial [Escherichia coli
           2-011-08_S1_C2]
 gb|KDA88732.1| hypothetical protein AD09_3560, partial [Escherichia coli
           1-176-05_S4_C2]
 gb|KDW12268.1| hypothetical protein AB86_4594, partial [Escherichia coli
           2-177-06_S3_C1]
 gb|KDW12711.1| hypothetical protein AB86_4407, partial [Escherichia coli
           2-177-06_S3_C1]
 gb|KDW14055.1| hypothetical protein AC68_4380, partial [Escherichia coli
           2-156-04_S4_C1]
 gb|KDW26568.1| hypothetical protein AC68_0193, partial [Escherichia coli
           2-156-04_S4_C1]
 gb|KDW26583.1| hypothetical protein AC68_0191, partial [Escherichia coli
           2-156-04_S4_C1]
 gb|KDX22635.1| hypothetical protein AB41_5178, partial [Escherichia coli
           1-250-04_S1_C2]
 gb|KDX25882.1| hypothetical protein AB41_4269, partial [Escherichia coli
           1-250-04_S1_C2]
 gb|KDX28857.1| hypothetical protein AB41_2863, partial [Escherichia coli
           1-250-04_S1_C2]
 gb|KDX31842.1| hypothetical protein AB41_1378, partial [Escherichia coli
           1-250-04_S1_C2]
 gb|KDX78493.1| hypothetical protein AB63_3747, partial [Escherichia coli
           2-222-05_S1_C3]
 gb|KDX79707.1| hypothetical protein AB63_2620, partial [Escherichia coli
           2-222-05_S1_C3]
 gb|KDX81320.1| hypothetical protein AB63_1232, partial [Escherichia coli
           2-222-05_S1_C3]
 gb|KDY25934.1| hypothetical protein AC48_4766, partial [Escherichia coli
           2-427-07_S3_C3]
 gb|KDY26213.1| hypothetical protein AC48_4743, partial [Escherichia coli
           2-427-07_S3_C3]
 gb|KDY26803.1| hypothetical protein AC48_4703, partial [Escherichia coli
           2-427-07_S3_C3]
 gb|KDY28467.1| hypothetical protein AC48_4313, partial [Escherichia coli
           2-427-07_S3_C3]
 gb|KDY29520.1| hypothetical protein AC48_3943, partial [Escherichia coli
           2-427-07_S3_C3]
 gb|KDY30193.1| hypothetical protein AC48_3584, partial [Escherichia coli
           2-427-07_S3_C3]
 gb|KDY33681.1| hypothetical protein AC48_1754, partial [Escherichia coli
           2-427-07_S3_C3]
 gb|KDZ17725.1| hypothetical protein AB43_5032, partial [Escherichia coli
           3-020-07_S1_C2]
 gb|KDZ20338.1| hypothetical protein AB43_4833, partial [Escherichia coli
           3-020-07_S1_C2]
 gb|KEJ21484.1| hypothetical protein AB32_4875, partial [Escherichia coli
           2-316-03_S1_C2]
 gb|KEJ21665.1| hypothetical protein AB32_4869, partial [Escherichia coli
           2-316-03_S1_C2]
 gb|KEJ21799.1| hypothetical protein AB32_4822, partial [Escherichia coli
           2-316-03_S1_C2]
 gb|KEJ22229.1| hypothetical protein AB32_4691, partial [Escherichia coli
           2-316-03_S1_C2]
 gb|KEJ22255.1| hypothetical protein AB32_4686, partial [Escherichia coli
           2-316-03_S1_C2]
 gb|KEJ22320.1| hypothetical protein AB32_4590, partial [Escherichia coli
           2-316-03_S1_C2]
 gb|KEJ33695.1| hypothetical protein AB32_0335, partial [Escherichia coli
           2-316-03_S1_C2]
 gb|KLV84590.1| hypothetical protein SK41_04680, partial [[Enterobacter] aerogenes]
 gb|KLV84695.1| hypothetical protein SK41_04640, partial [[Enterobacter] aerogenes]
 gb|KLV88655.1| hypothetical protein SK41_03631, partial [[Enterobacter] aerogenes]
 gb|KLV95657.1| hypothetical protein SK41_00001, partial [[Enterobacter] aerogenes]
 gb|KLW46395.1| hypothetical protein SK54_00107, partial [Enterobacter sp. MGH120]
 gb|KLW65381.1| hypothetical protein SK57_02759, partial [Enterobacter sp. BIDMC87]
 gb|OUE76827.1| hypothetical protein AZ013_001821, partial [Citrobacter freundii]
          Length = 38

 Score = 84.7 bits (208), Expect = 3e-19
 Identities = 38/38 (100%), Positives = 38/38 (100%)
 Frame = -3

Query: 174 ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 61
           ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG
Sbjct: 1   ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 38


>gb|EDU30654.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gb|EDU30693.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gb|EDU51709.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gb|EDU67425.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gb|EDU83352.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gb|EDV85350.1| conserved hypothetical protein [Escherichia coli E110019]
 gb|EDV86126.1| conserved hypothetical protein [Escherichia coli E110019]
 gb|ACF66991.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gb|EDX45015.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gb|EDX46726.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gb|ACF92250.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gb|ACF92444.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gb|ACF92820.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gb|ACH51180.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gb|EDZ03338.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gb|EDZ05927.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gb|EDZ36416.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gb|EFE06012.1| hypothetical protein CIT292_10608 [Citrobacter youngae ATCC 29220]
 gb|EFO55861.1| hypothetical protein HMPREF9348_05086 [Escherichia coli MS 145-7]
 gb|EFP98996.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gb|EFU53421.1| hypothetical protein HMPREF9544_01473 [Escherichia coli MS 153-1]
 gb|EFU60110.1| hypothetical protein HMPREF9545_00052 [Escherichia coli MS 16-3]
 gb|EFZ73586.1| hypothetical protein ECRN5871_3399 [Escherichia coli RN587/1]
 gb|EGI89595.1| hypothetical protein SB521682_4581 [Shigella boydii 5216-82]
 gb|EGM59773.1| hypothetical protein SFJ1713_4014 [Shigella flexneri SFJ17B]
 gb|EGM59860.1| hypothetical protein SFJ1713_3869 [Shigella flexneri SFJ17B]
 gb|EGM60020.1| hypothetical protein SFJ1713_3824 [Shigella flexneri SFJ17B]
 gb|EGM60037.1| hypothetical protein SFJ1713_3778 [Shigella flexneri SFJ17B]
 gb|EGT65974.1| hypothetical protein C22711_0001 [Escherichia coli O104:H4 str.
           C227-11]
 gb|EGT68983.1| hypothetical protein C22711_3013 [Escherichia coli O104:H4 str.
           C227-11]
 gb|EGT69289.1| hypothetical protein C22711_3319 [Escherichia coli O104:H4 str.
           C227-11]
 gb|EGT71072.1| hypothetical protein C22711_5106 [Escherichia coli O104:H4 str.
           C227-11]
 gb|EGT71293.1| hypothetical protein C22711_5329 [Escherichia coli O104:H4 str.
           C227-11]
 gb|EGT71379.1| hypothetical protein C22711_5420 [Escherichia coli O104:H4 str.
           C227-11]
 gb|EGW63250.1| hypothetical protein ECSTECC16502_4861 [Escherichia coli
           STEC_C165-02]
 gb|EGW65231.1| hypothetical protein ECSTECB2F1_4405 [Escherichia coli STEC_B2F1]
 gb|EGW67039.1| hypothetical protein ECSTECC16502_3244 [Escherichia coli
           STEC_C165-02]
 gb|EGW67989.1| hypothetical protein ECSTECB2F1_2772 [Escherichia coli STEC_B2F1]
 gb|EGX00858.1| hypothetical protein ECSTECMHI813_4432 [Escherichia coli
           STEC_MHI813]
 gb|EGX00971.1| hypothetical protein ECSTECMHI813_4299 [Escherichia coli
           STEC_MHI813]
 gb|EGX01479.1| hypothetical protein ECSTECMHI813_4195 [Escherichia coli
           STEC_MHI813]
 gb|EGX13456.1| hypothetical protein ECG581_0341 [Escherichia coli G58-1]
 gb|EGX14731.1| hypothetical protein ECSTECS1191_4780 [Escherichia coli STEC_S1191]
 gb|EGX15100.1| hypothetical protein ECSTECS1191_4323 [Escherichia coli STEC_S1191]
 gb|EGX16268.1| hypothetical protein ECSTECS1191_3499 [Escherichia coli STEC_S1191]
 gb|EHU05519.1| hypothetical protein ECDEC1C_3998 [Escherichia coli DEC1C]
 gb|EHU08033.1| hypothetical protein ECDEC1C_3145 [Escherichia coli DEC1C]
 gb|EHU64626.1| hypothetical protein ECDEC3B_1170 [Escherichia coli DEC3B]
 gb|EHU66039.1| hypothetical protein ECDEC3C_5407 [Escherichia coli DEC3C]
 gb|EHU80606.1| hypothetical protein ECDEC3F_5349 [Escherichia coli DEC3F]
 gb|EHU85303.1| hypothetical protein ECDEC3E_0328 [Escherichia coli DEC3E]
 gb|EHU92750.1| hypothetical protein ECDEC4B_4296 [Escherichia coli DEC4B]
 gb|EHV00648.1| hypothetical protein ECDEC4D_5009 [Escherichia coli DEC4D]
 gb|EHV01100.1| hypothetical protein ECDEC4D_4864 [Escherichia coli DEC4D]
 gb|EHV01213.1| hypothetical protein ECDEC4D_4760 [Escherichia coli DEC4D]
 gb|EHV19537.1| hypothetical protein ECDEC5A_4805 [Escherichia coli DEC5A]
 gb|EHV20155.1| hypothetical protein ECDEC5A_4764 [Escherichia coli DEC5A]
 gb|EHV20435.1| hypothetical protein ECDEC5A_4626 [Escherichia coli DEC5A]
 gb|EHV20845.1| hypothetical protein ECDEC5A_4531 [Escherichia coli DEC5A]
 gb|EHV24484.1| hypothetical protein ECDEC5B_5230 [Escherichia coli DEC5B]
 gb|EHV25355.1| hypothetical protein ECDEC5B_4987 [Escherichia coli DEC5B]
 gb|EHV33558.1| hypothetical protein ECDEC5D_4904 [Escherichia coli DEC5D]
 gb|EHV41509.1| hypothetical protein ECDEC5E_5015 [Escherichia coli DEC5E]
 gb|EHV52105.1| hypothetical protein ECDEC6A_4787 [Escherichia coli DEC6A]
 gb|EHV52311.1| hypothetical protein ECDEC6A_4655 [Escherichia coli DEC6A]
 gb|EHV55088.1| hypothetical protein ECDEC6C_4721 [Escherichia coli DEC6C]
 gb|EHV56554.1| hypothetical protein ECDEC6C_3939 [Escherichia coli DEC6C]
 gb|EHV67440.1| hypothetical protein ECDEC6E_5306 [Escherichia coli DEC6E]
 gb|EHV69498.1| hypothetical protein ECDEC6D_3110 [Escherichia coli DEC6D]
 gb|EHV96429.1| hypothetical protein ECDEC7E_4627 [Escherichia coli DEC7E]
 gb|EHW35969.1| hypothetical protein ECDEC8E_0207 [Escherichia coli DEC8E]
 gb|EHW51078.1| hypothetical protein ECDEC9E_4810 [Escherichia coli DEC9E]
 gb|EHW85766.1| hypothetical protein ECDEC11A_4470 [Escherichia coli DEC11A]
 gb|EHW86084.1| hypothetical protein ECDEC10F_5377 [Escherichia coli DEC10F]
 gb|EHW86566.1| hypothetical protein ECDEC10F_5272 [Escherichia coli DEC10F]
 gb|EHW88217.1| hypothetical protein ECDEC10F_4885 [Escherichia coli DEC10F]
 gb|EHW98912.1| hypothetical protein ECDEC11B_4691 [Escherichia coli DEC11B]
 gb|EHW99465.1| hypothetical protein ECDEC11B_4465 [Escherichia coli DEC11B]
 gb|EHX02654.1| hypothetical protein ECDEC10F_0502 [Escherichia coli DEC10F]
 gb|EHX04924.1| hypothetical protein ECDEC11D_4708 [Escherichia coli DEC11D]
 gb|EHX05256.1| hypothetical protein ECDEC11D_4518 [Escherichia coli DEC11D]
 gb|EHX15013.1| hypothetical protein ECDEC11E_4644 [Escherichia coli DEC11E]
 gb|EHX22208.1| hypothetical protein ECDEC12B_5303 [Escherichia coli DEC12B]
 gb|EHX39903.1| hypothetical protein ECDEC12D_4641 [Escherichia coli DEC12D]
 gb|EHX44547.1| hypothetical protein ECDEC12E_3976 [Escherichia coli DEC12E]
 gb|EHX56163.1| hypothetical protein ECDEC13C_4647 [Escherichia coli DEC13C]
 gb|EHX62776.1| hypothetical protein ECDEC13D_3007 [Escherichia coli DEC13D]
 gb|EHX72122.1| hypothetical protein ECDEC14A_4455 [Escherichia coli DEC14A]
 gb|EHX83462.1| hypothetical protein ECDEC14C_4811 [Escherichia coli DEC14C]
 gb|EHX90495.1| hypothetical protein ECDEC14D_3028 [Escherichia coli DEC14D]
 gb|EHX92627.1| hypothetical protein ECDEC15A_4993 [Escherichia coli DEC15A]
 gb|EHX93649.1| hypothetical protein ECDEC15A_4559 [Escherichia coli DEC15A]
 gb|EHX93826.1| hypothetical protein ECDEC15A_4480 [Escherichia coli DEC15A]
 gb|EHY21300.1| hypothetical protein ECDEC15E_0324 [Escherichia coli DEC15E]
 gb|EIE53236.1| hypothetical protein ECAI27_46170 [Escherichia coli AI27]
 gb|EIH15825.1| hypothetical protein EC990741_0217 [Escherichia coli 97.0259]
 gb|EIN32070.1| hypothetical protein ECFDA517_0298 [Escherichia coli FDA517]
 gb|EIN32128.1| hypothetical protein ECFDA505_0188 [Escherichia coli FDA505]
 gb|EIN47287.1| hypothetical protein EC93001_0302 [Escherichia coli 93-001]
 gb|EIN52008.1| hypothetical protein ECFRIK1985_0192 [Escherichia coli FRIK1985]
 gb|EIN64691.1| hypothetical protein ECPA3_0303 [Escherichia coli PA3]
 gb|EIN68096.1| hypothetical protein ECPA9_0342 [Escherichia coli PA9]
 gb|EIN69177.1| hypothetical protein ECPA5_0188 [Escherichia coli PA5]
 gb|EIN82547.1| hypothetical protein ECPA10_0193 [Escherichia coli PA10]
 gb|EIN83908.1| hypothetical protein ECPA22_5507 [Escherichia coli PA22]
 gb|EIN84038.1| hypothetical protein ECPA22_5364 [Escherichia coli PA22]
 gb|EIN84199.1| hypothetical protein ECPA22_5265 [Escherichia coli PA22]
 gb|EIN84570.1| hypothetical protein ECPA15_0343 [Escherichia coli PA15]
 gb|EIN87699.1| hypothetical protein ECPA14_0191 [Escherichia coli PA14]
 gb|EIO06152.1| hypothetical protein ECPA25_0006 [Escherichia coli PA25]
 gb|EIO06222.1| hypothetical protein ECPA24_0190 [Escherichia coli PA24]
 gb|EIO09243.1| hypothetical protein ECPA28_0343 [Escherichia coli PA28]
 gb|EIO22892.1| hypothetical protein ECPA31_0190 [Escherichia coli PA31]
 gb|EIO23176.1| hypothetical protein ECPA32_0214 [Escherichia coli PA32]
 gb|EIO26941.1| hypothetical protein ECPA33_0189 [Escherichia coli PA33]
 gb|EIO46727.1| hypothetical protein ECTW06591_4875 [Escherichia coli TW06591]
 gb|EIO46788.1| hypothetical protein ECTW06591_4736 [Escherichia coli TW06591]
 gb|EIO47640.1| hypothetical protein ECPA42_0340 [Escherichia coli PA42]
 gb|EIO55011.1| hypothetical protein ECPA39_0215 [Escherichia coli PA39]
 gb|EIO60589.1| hypothetical protein ECTW11039_5213 [Escherichia coli TW11039]
 gb|EIO69980.1| hypothetical protein ECTW11039_0343 [Escherichia coli TW11039]
 gb|EIO70128.1| hypothetical protein ECTW11039_5877 [Escherichia coli TW11039]
 gb|EIO78376.1| hypothetical protein ECTW07945_0334 [Escherichia coli TW07945]
 gb|EIO79954.1| hypothetical protein ECTW10119_5773 [Escherichia coli TW10119]
 gb|EIO90571.1| hypothetical protein ECTW09098_0286 [Escherichia coli TW09098]
 gb|EIP02154.1| hypothetical protein ECEC4203_0192 [Escherichia coli EC4203]
 gb|EIP04912.1| hypothetical protein ECEC4196_0192 [Escherichia coli EC4196]
 gb|EIP08364.1| hypothetical protein ECTW09195_0212 [Escherichia coli TW09195]
 gb|EIP19052.1| hypothetical protein ECTW14301_0194 [Escherichia coli TW14301]
 gb|EIP23584.1| hypothetical protein ECEC4421_0189 [Escherichia coli EC4421]
 gb|EIP24551.1| hypothetical protein ECTW14313_0192 [Escherichia coli O157:H7 str.
           TW14313]
 gb|EIP33686.1| hypothetical protein ECEC4422_0341 [Escherichia coli EC4422]
 gb|EIP38521.1| hypothetical protein ECEC4013_0409 [Escherichia coli EC4013]
 gb|EIP47050.1| hypothetical protein ECEC4402_0193 [Escherichia coli EC4402]
 gb|EIP48574.1| hypothetical protein ECEC4439_0192 [Escherichia coli EC4439]
 gb|EIP55367.1| hypothetical protein ECEC4436_0190 [Escherichia coli EC4436]
 gb|EIP57121.1| hypothetical protein ECEC1738_5087 [Escherichia coli EC1738]
 gb|EIP57786.1| hypothetical protein ECEC1738_4458 [Escherichia coli EC1738]
 gb|EIP64362.1| hypothetical protein ECEC1734_5379 [Escherichia coli EC1734]
 gb|EIP75718.1| hypothetical protein ECEC4448_0192 [Escherichia coli EC4448]
 gb|EIP83142.1| hypothetical protein ECEC1863_0005 [Escherichia coli EC1863]
 gb|EIP84147.1| hypothetical protein ECEC1845_0192 [Escherichia coli EC1845]
 gb|EIQ23036.1| hypothetical protein SB96558_4966 [Shigella boydii 965-58]
 gb|EIQ25791.1| hypothetical protein SB96558_4199 [Shigella boydii 965-58]
 gb|EIQ34010.1| hypothetical protein SFK404_0263 [Shigella flexneri K-404]
 gb|EIQ35811.1| hypothetical protein SB444474_3097 [Shigella boydii 4444-74]
 gb|EIQ59471.1| hypothetical protein SF123566_6534 [Shigella flexneri 1235-66]
 gb|EIQ61197.1| hypothetical protein SF123566_6242 [Shigella flexneri 1235-66]
 gb|EIQ63788.1| hypothetical protein SF123566_6068 [Shigella flexneri 1235-66]
 gb|EIQ64783.1| hypothetical protein SF123566_5844 [Shigella flexneri 1235-66]
 gb|EIQ73543.1| hypothetical protein SF123566_4583 [Shigella flexneri 1235-66]
 gb|EIQ80258.1| hypothetical protein SF123566_8292 [Shigella flexneri 1235-66]
 gb|EJK93752.1| hypothetical protein ECSTECO31_4437 [Escherichia coli STEC_O31]
 gb|EJK93933.1| hypothetical protein ECSTECO31_4300 [Escherichia coli STEC_O31]
 gb|EJK94043.1| hypothetical protein ECSTECO31_4199 [Escherichia coli STEC_O31]
 gb|EJK94480.1| hypothetical protein ECSTECO31_3599 [Escherichia coli STEC_O31]
 gb|EJK95251.1| hypothetical protein ECSTECO31_2818 [Escherichia coli STEC_O31]
 gb|EKG95880.1| hypothetical protein ECPA7_5599 [Escherichia coli PA7]
 gb|EKH07086.1| hypothetical protein ECPA7_0713 [Escherichia coli PA7]
 gb|EKH20674.1| hypothetical protein ECPA34_0344 [Escherichia coli PA34]
 gb|EKH24851.1| hypothetical protein ECFDA506_0666 [Escherichia coli FDA506]
 gb|EKH30302.1| hypothetical protein ECFDA507_0199 [Escherichia coli FDA507]
 gb|EKH35911.1| hypothetical protein ECFDA504_0340 [Escherichia coli FDA504]
 gb|EKH48477.1| hypothetical protein ECFRIK1997_0345 [Escherichia coli FRIK1997]
 gb|EKH60991.1| hypothetical protein ECNE037_0344 [Escherichia coli NE037]
 gb|EKH71450.1| hypothetical protein ECPA4_0343 [Escherichia coli PA4]
 gb|EKH79381.1| hypothetical protein ECPA23_0154 [Escherichia coli PA23]
 gb|EKH82735.1| hypothetical protein ECPA49_0343 [Escherichia coli PA49]
 gb|EKH87455.1| hypothetical protein ECPA45_0341 [Escherichia coli PA45]
 gb|EKH95316.1| hypothetical protein ECTT12B_0342 [Escherichia coli TT12B]
 gb|EKI13747.1| hypothetical protein ECCB7326_0195 [Escherichia coli CB7326]
 gb|EKI19080.1| hypothetical protein EC5412_0274 [Escherichia coli 5412]
 gb|EKI19354.1| hypothetical protein ECEC96038_0143 [Escherichia coli EC96038]
 gb|EKI24910.1| hypothetical protein ECTW15901_0202 [Escherichia coli TW15901]
 gb|EKI31390.1| hypothetical protein ECTW00353_0195 [Escherichia coli TW00353]
 gb|EKI57244.1| hypothetical protein ECPA38_0195 [Escherichia coli PA38]
 gb|EKI63374.1| hypothetical protein ECEC1735_0299 [Escherichia coli EC1735]
 gb|EKI72062.1| hypothetical protein ECEC1736_0190 [Escherichia coli EC1736]
 gb|EKI76049.1| hypothetical protein ECEC1737_0191 [Escherichia coli EC1737]
 gb|EKI81839.1| hypothetical protein ECEC1846_0189 [Escherichia coli EC1846]
 gb|EKI89571.1| hypothetical protein ECEC1847_0190 [Escherichia coli EC1847]
 gb|EKI91317.1| hypothetical protein ECEC1848_0405 [Escherichia coli EC1848]
 gb|EKJ05092.1| hypothetical protein ECEC1850_0359 [Escherichia coli EC1850]
 gb|EKJ07811.1| hypothetical protein ECEC1856_0200 [Escherichia coli EC1856]
 gb|EKJ19234.1| hypothetical protein ECEC1862_0194 [Escherichia coli EC1862]
 gb|EKJ19279.1| hypothetical protein ECEC1864_0345 [Escherichia coli EC1864]
 gb|EKJ27925.1| hypothetical protein ECEC1865_0213 [Escherichia coli EC1865]
 gb|EKJ35525.1| hypothetical protein ECEC1868_0345 [Escherichia coli EC1868]
 gb|EKJ35691.1| hypothetical protein ECEC1866_0006 [Escherichia coli EC1866]
 gb|EKJ47377.1| hypothetical protein ECEC1869_0345 [Escherichia coli EC1869]
 gb|EKJ52743.1| hypothetical protein ECNE098_0341 [Escherichia coli NE098]
 gb|EKJ54104.1| hypothetical protein ECEC1870_0006 [Escherichia coli EC1870]
 gb|EKJ62325.1| hypothetical protein EC01288_0193 [Escherichia coli 0.1288]
 gb|EKJ64870.1| hypothetical protein ECFRIK523_0200 [Escherichia coli FRIK523]
 gb|EKJ67031.1| hypothetical protein EC01304_0246 [Escherichia coli 0.1304]
 gb|EKK36440.1| hypothetical protein EC52239_0339 [Escherichia coli 5.2239]
 gb|EKK36483.1| hypothetical protein EC34870_0340 [Escherichia coli 3.4870]
 gb|EKK37586.1| hypothetical protein EC60172_0342 [Escherichia coli 6.0172]
 gb|EKK60792.1| hypothetical protein EC80586_0348 [Escherichia coli 8.0586]
 gb|EKK66317.1| hypothetical protein EC82524_0220 [Escherichia coli 8.2524]
 gb|EKK67661.1| hypothetical protein EC100833_0411 [Escherichia coli 10.0833]
 gb|EKK78911.1| hypothetical protein EC100869_0142 [Escherichia coli 10.0869]
 gb|EKK86670.1| hypothetical protein EC880221_0406 [Escherichia coli 88.0221]
 gb|EKV84693.1| hypothetical protein EC881042_0339 [Escherichia coli 88.1042]
 gb|EKV87804.1| hypothetical protein EC890511_0199 [Escherichia coli 89.0511]
 gb|EKW02758.1| hypothetical protein EC902281_0341 [Escherichia coli 90.2281]
 gb|EKW05030.1| hypothetical protein EC900091_0409 [Escherichia coli 90.0091]
 gb|EKW18698.1| hypothetical protein EC930056_0340 [Escherichia coli 93.0056]
 gb|EKW20247.1| hypothetical protein EC930055_0200 [Escherichia coli 93.0055]
 gb|EKW21107.1| hypothetical protein EC940618_0199 [Escherichia coli 94.0618]
 gb|EKW36253.1| hypothetical protein EC950943_0340 [Escherichia coli 95.0943]
 gb|EKW42782.1| hypothetical protein EC951288_0193 [Escherichia coli 95.1288]
 gb|EKW50992.1| hypothetical protein EC960428_0342 [Escherichia coli 96.0428]
 gb|EKW56412.1| hypothetical protein EC960427_0191 [Escherichia coli 96.0427]
 gb|EKW59712.1| hypothetical protein EC970003_4965 [Escherichia coli 97.0003]
 gb|EKW60491.1| hypothetical protein EC970003_4750 [Escherichia coli 97.0003]
 gb|EKW60694.1| hypothetical protein EC970003_4656 [Escherichia coli 97.0003]
 gb|EKW67826.1| hypothetical protein EC970003_0341 [Escherichia coli 97.0003]
 gb|EKW72236.1| hypothetical protein EC970007_4691 [Escherichia coli 97.0007]
 gb|EKW72357.1| hypothetical protein EC970007_4654 [Escherichia coli 97.0007]
 gb|EKW72869.1| hypothetical protein EC970007_4514 [Escherichia coli 97.0007]
 gb|EKW73116.1| hypothetical protein EC970007_4415 [Escherichia coli 97.0007]
 gb|EKW74108.1| hypothetical protein EC960107_0340 [Escherichia coli 96.0107]
 gb|EKY44234.1| hypothetical protein EC960109_0191 [Escherichia coli 96.0109]
 gb|EKY45595.1| hypothetical protein EC970010_0192 [Escherichia coli 97.0010]
 emb|CCQ01328.1| hypothetical protein ECK4_17860 [Escherichia coli O5:K4(L):H4 str.
           ATCC 23502]
 emb|CCQ08514.1| hypothetical protein [Escherichia coli Nissle 1917]
 emb|CCG31618.1| hypothetical protein [Klebsiella aerogenes EA1509E]
 emb|CCG31991.1| hypothetical protein [Klebsiella aerogenes EA1509E]
 emb|CCG32350.1| hypothetical protein [Klebsiella aerogenes EA1509E]
 emb|CCG32385.1| hypothetical protein [Klebsiella aerogenes EA1509E]
 emb|CCG32464.1| hypothetical protein [Klebsiella aerogenes EA1509E]
 emb|CCG32549.1| hypothetical protein [Klebsiella aerogenes EA1509E]
 emb|CCG33046.1| hypothetical protein [Klebsiella aerogenes EA1509E]
 emb|CCG33916.1| hypothetical protein [Klebsiella aerogenes EA1509E]
 gb|ELV14814.1| hypothetical protein EC990814_4757 [Escherichia coli 99.0814]
 gb|ELV14960.1| hypothetical protein EC990814_4570 [Escherichia coli 99.0814]
 gb|ELV22569.1| hypothetical protein EC990814_0187 [Escherichia coli 99.0814]
 gb|ELV29836.1| hypothetical protein EC09BKT78844_0284 [Escherichia coli
           09BKT078844]
 gb|ELV31332.1| hypothetical protein EC990816_4848 [Escherichia coli 99.0816]
 gb|ELV31706.1| hypothetical protein EC990816_4707 [Escherichia coli 99.0816]
 gb|ELV32109.1| hypothetical protein EC990839_4473 [Escherichia coli 99.0839]
 gb|ELV36001.1| hypothetical protein EC990848_4817 [Escherichia coli 99.0848]
 gb|ELV36419.1| hypothetical protein EC990848_4684 [Escherichia coli 99.0848]
 gb|ELV36503.1| hypothetical protein EC990848_4590 [Escherichia coli 99.0848]
 gb|ELV44937.1| hypothetical protein EC990816_0186 [Escherichia coli 99.0816]
 gb|ELV44947.1| hypothetical protein EC991753_4790 [Escherichia coli 99.1753]
 gb|ELV45272.1| hypothetical protein EC991753_4704 [Escherichia coli 99.1753]
 gb|ELV45394.1| hypothetical protein EC991753_4594 [Escherichia coli 99.1753]
 gb|ELV45570.1| hypothetical protein EC991753_4501 [Escherichia coli 99.1753]
 gb|ELV48166.1| hypothetical protein EC991775_4644 [Escherichia coli 99.1775]
 gb|ELV49201.1| hypothetical protein EC990848_0185 [Escherichia coli 99.0848]
 gb|ELV51322.1| hypothetical protein EC991793_5167 [Escherichia coli 99.1793]
 gb|ELV51858.1| hypothetical protein EC991793_4955 [Escherichia coli 99.1793]
 gb|ELV52204.1| hypothetical protein EC991793_4857 [Escherichia coli 99.1793]
 gb|ELV61931.1| hypothetical protein EC991775_0246 [Escherichia coli 99.1775]
 gb|ELV63028.1| hypothetical protein EC991805_4648 [Escherichia coli 99.1805]
 gb|ELV63220.1| hypothetical protein EC991805_4517 [Escherichia coli 99.1805]
 gb|ELV63825.1| hypothetical protein ECATCC700728_4723 [Escherichia coli ATCC
           700728]
 gb|ELV64018.1| hypothetical protein ECATCC700728_4683 [Escherichia coli ATCC
           700728]
 gb|ELV64278.1| hypothetical protein ECATCC700728_4543 [Escherichia coli ATCC
           700728]
 gb|ELV93647.1| hypothetical protein ECPA48_4572 [Escherichia coli PA48]
 gb|ELV94360.1| hypothetical protein ECPA48_4301 [Escherichia coli PA48]
 gb|ELW07076.1| hypothetical protein ECPA48_0139 [Escherichia coli PA48]
 gb|ELW08103.1| hypothetical protein EC71982_4852 [Escherichia coli 7.1982]
 gb|ELW08388.1| hypothetical protein EC71982_4687 [Escherichia coli 7.1982]
 gb|ELW09464.1| hypothetical protein EC991781_4994 [Escherichia coli 99.1781]
 gb|ELW09894.1| hypothetical protein EC991781_4952 [Escherichia coli 99.1781]
 gb|ELW10422.1| hypothetical protein EC991781_4727 [Escherichia coli 99.1781]
 gb|ELW14577.1| hypothetical protein EC991762_4981 [Escherichia coli 99.1762]
 gb|ELW23615.1| hypothetical protein ECPA35_5031 [Escherichia coli PA35]
 gb|ELW27535.1| hypothetical protein EC991762_0335 [Escherichia coli 99.1762]
 gb|ELW31884.1| hypothetical protein EC950083_4576 [Escherichia coli 95.0083]
 gb|ELW32183.1| hypothetical protein EC950083_4478 [Escherichia coli 95.0083]
 gb|ELW35784.1| hypothetical protein EC950083_3213 [Escherichia coli 95.0083]
 gb|ELW36197.1| hypothetical protein ECPA35_0393 [Escherichia coli PA35]
 gb|EMU57263.1| hypothetical protein ECMP02155211_4273 [Escherichia coli
           MP021552.11]
 gb|EMW81677.1| hypothetical protein EC2747800_0205 [Escherichia coli 2747800]
 gb|EMW92708.1| hypothetical protein ECTHROOPD_5002 [Escherichia coli ThroopD]
 gb|EMW93146.1| hypothetical protein ECTHROOPD_4813 [Escherichia coli ThroopD]
 gb|EMW94366.1| hypothetical protein ECTHROOPD_3374 [Escherichia coli ThroopD]
 gb|EMX02485.1| hypothetical protein ECTHROOPD_0326 [Escherichia coli ThroopD]
 gb|EMX04421.1| hypothetical protein ECP03023081_4818 [Escherichia coli P0302308.1]
 gb|EMX05390.1| hypothetical protein ECP03023081_4541 [Escherichia coli P0302308.1]
 gb|EMX09848.1| hypothetical protein ECP03023081_0529 [Escherichia coli P0302308.1]
 gb|EMX16752.1| hypothetical protein ECP03018671_4601 [Escherichia coli P0301867.1]
 gb|EMX17627.1| hypothetical protein ECP03018671_3895 [Escherichia coli P0301867.1]
 gb|EMX18223.1| hypothetical protein ECP03018671_3098 [Escherichia coli P0301867.1]
 gb|EMX20556.1| hypothetical protein ECMP0215661_4845 [Escherichia coli MP021566.1]
 gb|EMX23410.1| hypothetical protein ECP03018671_0276 [Escherichia coli P0301867.1]
 gb|EMX28216.1| hypothetical protein ECMP0215612_4757 [Escherichia coli MP021561.2]
 gb|EMX28467.1| hypothetical protein ECMP0215612_4664 [Escherichia coli MP021561.2]
 gb|EMX33240.1| hypothetical protein ECMP0215612_0613 [Escherichia coli MP021561.2]
 gb|EMX34931.1| hypothetical protein ECMP0215528_4329 [Escherichia coli MP021552.8]
 gb|EMX58521.1| hypothetical protein ECJURUA1811_4555 [Escherichia coli Jurua
           18/11]
 gb|EMX59876.1| hypothetical protein ECJURUA1811_4291 [Escherichia coli Jurua
           18/11]
 gb|EMX60775.1| hypothetical protein ECMP0209401_0363 [Escherichia coli MP020940.1]
 gb|EMX65094.1| hypothetical protein ECENVIRA101_4671 [Escherichia coli Envira
           10/1]
 gb|EMX66470.1| hypothetical protein ECENVIRA101_4067 [Escherichia coli Envira
           10/1]
 gb|EMX76204.1| hypothetical protein EC2726800_3225 [Escherichia coli 2726800]
 gb|EMX81576.1| hypothetical protein EC2719100_4811 [Escherichia coli 2719100]
 gb|EMX81868.1| hypothetical protein EC2726800_0320 [Escherichia coli 2726800]
 gb|EMX84351.1| hypothetical protein ECBCE001MS16_4163 [Escherichia coli
           BCE001_MS16]
 gb|EMX85044.1| hypothetical protein ECBCE001MS16_3632 [Escherichia coli
           BCE001_MS16]
 gb|EMX85697.1| hypothetical protein EC2720900_4592 [Escherichia coli 2720900]
 gb|EMX96463.1| hypothetical protein EC2720900_0355 [Escherichia coli 2720900]
 gb|EMZ79787.1| hypothetical protein ECP03052931_4825 [Escherichia coli p0305293.1]
 gb|EMZ80309.1| hypothetical protein ECP03052931_4667 [Escherichia coli p0305293.1]
 gb|EMZ80778.1| hypothetical protein ECP03052931_4570 [Escherichia coli p0305293.1]
 gb|EMZ81152.1| hypothetical protein ECP03052931_4016 [Escherichia coli p0305293.1]
 gb|EMZ81600.1| hypothetical protein ECP03052931_3970 [Escherichia coli p0305293.1]
 gb|EMZ88561.1| hypothetical protein ECP03052931_0252 [Escherichia coli p0305293.1]
 gb|EMZ90017.1| hypothetical protein ECP03052601_4194 [Escherichia coli P0305260.1]
 gb|EMZ90127.1| hypothetical protein ECP03052601_4150 [Escherichia coli P0305260.1]
 gb|EMZ90181.1| hypothetical protein ECP03052601_4023 [Escherichia coli P0305260.1]
 gb|EMZ90381.1| hypothetical protein ECP03052601_3930 [Escherichia coli P0305260.1]
 gb|ENA15828.1| hypothetical protein EC2016001_5014 [Escherichia coli 201600.1]
 gb|ENA16779.1| hypothetical protein EC2016001_4857 [Escherichia coli 201600.1]
 gb|ENA18462.1| hypothetical protein EC2016001_4223 [Escherichia coli 201600.1]
 gb|ENA24323.1| hypothetical protein ECP02989421_0255 [Escherichia coli P0298942.1]
 gb|ENA25882.1| hypothetical protein EC2016001_0620 [Escherichia coli 201600.1]
 gb|ENA27444.1| hypothetical protein ECBCE007MS11_4415 [Escherichia coli
           BCE007_MS-11]
 gb|ENB31845.1| hypothetical protein ECMP0215613_4436 [Escherichia coli MP021561.3]
 gb|ENB32295.1| hypothetical protein ECMP0215613_4270 [Escherichia coli MP021561.3]
 gb|ENB32516.1| hypothetical protein ECMP0215613_4172 [Escherichia coli MP021561.3]
 gb|ENB43900.1| hypothetical protein ECMP0215613_0207 [Escherichia coli MP021561.3]
 gb|ENB48451.1| hypothetical protein ECMP0215613_5091 [Escherichia coli MP021561.3]
 gb|ENB90738.1| hypothetical protein ECP029943810_0189 [Escherichia coli
           P0299438.10]
 gb|END56377.1| hypothetical protein ECMP0209801_0321 [Escherichia coli MP020980.1]
 gb|END66542.1| hypothetical protein ECP02989424_2905 [Escherichia coli P0298942.4]
 gb|END73963.1| hypothetical protein ECP02994831_0430 [Escherichia coli P0299483.1]
 gb|END75752.1| hypothetical protein ECP02989424_0195 [Escherichia coli P0298942.4]
 gb|END75893.1| hypothetical protein ECP02989423_0196 [Escherichia coli P0298942.3]
 gb|END83971.1| hypothetical protein ECP02994832_0443 [Escherichia coli P0299483.2]
 gb|ENE00766.1| hypothetical protein ECP03019043_0195 [Escherichia coli P0301904.3]
 gb|ENE02662.1| hypothetical protein ECP03022937_0208 [Escherichia coli P0302293.7]
 gb|ENE07665.1| hypothetical protein ECP03047993_2856 [Escherichia coli P0304799.3]
 gb|ENE13759.1| hypothetical protein ECP03052602_0199 [Escherichia coli P0305260.2]
 gb|ENE66351.1| hypothetical protein ECP030477714_4418 [Escherichia coli
           P0304777.14]
 gb|ENE66803.1| hypothetical protein ECP030477714_4307 [Escherichia coli
           P0304777.14]
 gb|ENE67151.1| hypothetical protein ECP030477714_4213 [Escherichia coli
           P0304777.14]
 gb|ENE76676.1| hypothetical protein ECP030477714_0213 [Escherichia coli
           P0304777.14]
 gb|ENG61097.1| hypothetical protein ECP03052932_0203 [Escherichia coli p0305293.2]
 gb|ENG70046.1| hypothetical protein ECP03052934_0204 [Escherichia coli p0305293.4]
 emb|CCR03320.1| hypothetical protein SA73_4579 [Salmonella enterica subsp. enterica
           serovar Agona str. 73.H.09]
 emb|CCR12526.1| hypothetical protein SA71_4556 [Salmonella enterica subsp. enterica
           serovar Agona str. 71.E.05]
 emb|CCR17133.1| hypothetical protein SA70_4560 [Salmonella enterica subsp. enterica
           serovar Agona str. 70.E.05]
 emb|CCR21836.1| hypothetical protein SA69_4607 [Salmonella enterica subsp. enterica
           serovar Agona str. 69.H.06]
 emb|CCR25368.1| hypothetical protein SA68_3386 [Salmonella enterica subsp. enterica
           serovar Agona str. 68.U.05]
 emb|CCR40480.1| hypothetical protein SA64_4551 [Salmonella enterica subsp. enterica
           serovar Agona str. 64.H.00]
 emb|CCR54491.1| hypothetical protein SA61_4654 [Salmonella enterica subsp. enterica
           serovar Agona str. 61.O.08]
 emb|CCR59070.1| hypothetical protein SA60_4654 [Salmonella enterica subsp. enterica
           serovar Agona str. 60.O.08]
 emb|CCR63568.1| hypothetical protein SA59_4532 [Salmonella enterica subsp. enterica
           serovar Agona str. 59.F.08]
 emb|CCR67390.1| hypothetical protein SA58_3712 [Salmonella enterica subsp. enterica
           serovar Agona str. 58.E.08]
 emb|CCR71813.1| hypothetical protein SA56_3526 [Salmonella enterica subsp. enterica
           serovar Agona str. 56.O.08]
 emb|CCR76348.1| hypothetical protein SA55_3442 [Salmonella enterica subsp. enterica
           serovar Agona str. 55.U.08]
 emb|CCR82001.1| hypothetical protein SA54_4508 [Salmonella enterica subsp. enterica
           serovar Agona str. 54.O.08]
 emb|CCR85439.1| hypothetical protein SA53_3304 [Salmonella enterica subsp. enterica
           serovar Agona str. 53.F.08]
 emb|CCR89977.1| hypothetical protein SA52_3231 [Salmonella enterica subsp. enterica
           serovar Agona str. 52.F.08]
 emb|CCR92707.1| hypothetical protein SA51_1335 [Salmonella enterica subsp. enterica
           serovar Agona str. 51.E.09]
 emb|CCS00495.1| hypothetical protein SA50_4627 [Salmonella enterica subsp. enterica
           serovar Agona str. 50.E.08]
 emb|CCS05039.1| hypothetical protein SA48_4539 [Salmonella enterica subsp. enterica
           serovar Agona str. 48.E.08]
 emb|CCS05709.1| hypothetical protein SA46_0500 [Salmonella enterica subsp. enterica
           serovar Agona str. 46.E.09]
 emb|CCT80851.1| hypothetical protein SA08_4605 [Salmonella enterica subsp. enterica
           serovar Agona str. 08.A.05]
 emb|CCT85650.1| hypothetical protein SA07_4705 [Salmonella enterica subsp. enterica
           serovar Agona str. 07.O.05]
 emb|CCT86220.1| hypothetical protein SA06_0437 [Salmonella enterica subsp. enterica
           serovar Agona str. 06.O.05]
 emb|CCT91010.1| hypothetical protein SA05_0461 [Salmonella enterica subsp. enterica
           serovar Agona str. 05.O.06]
 emb|CCT97029.1| hypothetical protein SA04_1858 [Salmonella enterica subsp. enterica
           serovar Agona str. 04.O.05]
 emb|CCU04502.1| hypothetical protein SA03_4714 [Salmonella enterica subsp. enterica
           serovar Agona str. 03.O.05]
 emb|CCU09325.1| hypothetical protein SA02_4809 [Salmonella enterica subsp. enterica
           serovar Agona str. 02.O.05]
 emb|CCU09823.1| hypothetical protein SA01_0437 [Salmonella enterica subsp. enterica
           serovar Agona str. 01.O.05]
 emb|CCU18515.1| hypothetical protein SA10_4514 [Salmonella enterica subsp. enterica
           serovar Agona str. 10.A.05]
 emb|CCU23214.1| hypothetical protein SA67_4614 [Salmonella enterica subsp. enterica
           serovar Agona str. 67.H.09]
 emb|CCU32326.1| hypothetical protein SA49_4548 [Salmonella enterica subsp. enterica
           serovar Agona str. 49.E.09]
 emb|CCU36660.1| hypothetical protein SA39_4545 [Salmonella enterica subsp. enterica
           serovar Agona str. 39.O.03]
 emb|CCU40340.1| hypothetical protein SA30_3683 [Salmonella enterica subsp. enterica
           serovar Agona str. 30.H.04]
 emb|CCU45907.1| hypothetical protein SA26_4575 [Salmonella enterica subsp. enterica
           serovar Agona str. 26.F.98]
 emb|CCU55164.1| hypothetical protein SA16_4568 [Salmonella enterica subsp. enterica
           serovar Agona str. 16.H.08]
 emb|CCS18419.1| hypothetical protein SA44_4220 [Salmonella enterica subsp. enterica
           serovar Agona str. 44.E.09]
 emb|CCS23340.1| hypothetical protein SA43_4520 [Salmonella enterica subsp. enterica
           serovar Agona str. 43.E.09]
 emb|CCS27548.1| hypothetical protein SA42_4194 [Salmonella enterica subsp. enterica
           serovar Agona str. 42.E.09]
 emb|CCS31884.1| hypothetical protein SA40A_3872 [Salmonella enterica subsp.
           enterica serovar Agona str. 40.E.08]
 emb|CCS36778.1| hypothetical protein SA41_4188 [Salmonella enterica subsp. enterica
           serovar Agona str. 41.E.09]
 emb|CCS41760.1| hypothetical protein SA38_4571 [Salmonella enterica subsp. enterica
           serovar Agona str. 38.O.03]
 emb|CCS51077.1| hypothetical protein SA36_4614 [Salmonella enterica subsp. enterica
           serovar Agona str. 36.H.00]
 emb|CCS55809.1| hypothetical protein SA35_4653 [Salmonella enterica subsp. enterica
           serovar Agona str. 35.H.08]
 emb|CCS58966.1| hypothetical protein SA34_3120 [Salmonella enterica subsp. enterica
           serovar Agona str. 34.H.09]
 emb|CCS64976.1| hypothetical protein SA33_4508 [Salmonella enterica subsp. enterica
           serovar Agona str. 33.A.05]
 emb|CCS66091.1| hypothetical protein SA32_0957 [Salmonella enterica subsp. enterica
           serovar Agona str. 32.A.00]
 emb|CCS73198.1| hypothetical protein SA31_3420 [Salmonella enterica subsp. enterica
           serovar Agona str. 31.H.09]
 emb|CCS78855.1| hypothetical protein SA29_4596 [Salmonella enterica subsp. enterica
           serovar Agona str. 29.O.08]
 emb|CCS83445.1| hypothetical protein SA28_4559 [Salmonella enterica subsp. enterica
           serovar Agona str. 28.O.08]
 emb|CCS86087.1| hypothetical protein SA27_2528 [Salmonella enterica subsp. enterica
           serovar Agona str. 27.O.98]
 emb|CCS91751.1| hypothetical protein SA24_3573 [Salmonella enterica subsp. enterica
           serovar Agona str. 24.H.04]
 emb|CCS93417.1| hypothetical protein SA23_0494 [Salmonella enterica subsp. enterica
           serovar Agona str. 23.F.01]
 emb|CCS98122.1| hypothetical protein SA22_0488 [Salmonella enterica subsp. enterica
           serovar Agona str. 22.H.04]
 emb|CCT02839.1| hypothetical protein SA21_0524 [Salmonella enterica subsp. enterica
           serovar Agona str. 21.H.10]
 emb|CCT11720.1| hypothetical protein SA20_4720 [Salmonella enterica subsp. enterica
           serovar Agona str. 20.H.06]
 emb|CCT12044.1| hypothetical protein SA19_0244 [Salmonella enterica subsp. enterica
           serovar Agona str. 19.F.03]
 emb|CCT20939.1| hypothetical protein SA18_4602 [Salmonella enterica subsp. enterica
           serovar Agona str. 18.H.07]
 emb|CCT21570.1| hypothetical protein SA17_0507 [Salmonella enterica subsp. enterica
           serovar Agona str. 17.H.06]
 emb|CCT33474.1| hypothetical protein SA15_3119 [Salmonella enterica subsp. enterica
           serovar Agona str. 15.H.03]
 emb|CCT38862.1| hypothetical protein SA14_3870 [Salmonella enterica subsp. enterica
           serovar Agona str. 14.E.05]
 emb|CCT43779.1| hypothetical protein SA13_4134 [Salmonella enterica subsp. enterica
           serovar Agona str. 13.E.05]
 emb|CCT48809.1| hypothetical protein SA12_4539 [Salmonella enterica subsp. enterica
           serovar Agona str. 12.A.06]
 emb|CCT53379.1| hypothetical protein SA11_4500 [Salmonella enterica subsp. enterica
           serovar Agona str. 11.A.05]
 emb|CCT58021.1| hypothetical protein SA09_4515 [Salmonella enterica subsp. enterica
           serovar Agona str. 09.F.08]
 gb|EOW56386.1| hypothetical protein A319_04136 [Escherichia coli KTE155]
 gb|AGN86643.1| hypothetical protein H650_16420 [Enterobacter sp. R4-368]
 gb|ERB67695.1| hypothetical protein QYC_4954 [Escherichia coli B102]
 gb|ERB68924.1| hypothetical protein QYC_4734 [Escherichia coli B102]
 gb|ERB69112.1| hypothetical protein QYC_4640 [Escherichia coli B102]
 gb|ERB69378.1| hypothetical protein EC09BKT76207_5126 [Escherichia coli
           09BKT076207]
 gb|ERB69467.1| hypothetical protein EC09BKT76207_5088 [Escherichia coli
           09BKT076207]
 gb|ERB70057.1| hypothetical protein EC09BKT76207_4941 [Escherichia coli
           09BKT076207]
 gb|ERB79769.1| hypothetical protein EC09BKT76207_1438 [Escherichia coli
           09BKT076207]
 gb|ERB88554.1| hypothetical protein S13_4761 [Escherichia coli B26-2]
 gb|ERB88633.1| hypothetical protein QYC_0338 [Escherichia coli B102]
 gb|ERB90661.1| hypothetical protein QYC_5324 [Escherichia coli B102]
 gb|ERC00420.1| hypothetical protein S13_0405 [Escherichia coli B26-2]
 gb|ERC15062.1| hypothetical protein QYO_0338 [Escherichia coli B29-1]
 gb|ERC25813.1| hypothetical protein QYG_4874 [Escherichia coli B7-1]
 gb|ERC35326.1| hypothetical protein S1C_5018 [Escherichia coli B93]
 gb|ERC62424.1| hypothetical protein ECBD561099_4900 [Escherichia coli Bd5610_99]
 gb|ERC62880.1| hypothetical protein ECBD561099_4663 [Escherichia coli Bd5610_99]
 gb|ERC66640.1| hypothetical protein ECT184097_4665 [Escherichia coli T1840_97]
 gb|ERC74279.1| hypothetical protein ECBD561099_0244 [Escherichia coli Bd5610_99]
 gb|ERC77957.1| hypothetical protein ECT184097_0170 [Escherichia coli T1840_97]
 gb|ERC81541.1| hypothetical protein ECT92401_4908 [Escherichia coli T924_01]
 gb|ERC81689.1| hypothetical protein ECT92401_4751 [Escherichia coli T924_01]
 gb|ERC81825.1| hypothetical protein ECT92401_4659 [Escherichia coli T924_01]
 gb|ERC83608.1| hypothetical protein ECT92401_3599 [Escherichia coli T924_01]
 gb|ERC90418.1| hypothetical protein B233_4881 [Escherichia coli 2886-75]
 gb|ERC90725.1| hypothetical protein ECT92401_0375 [Escherichia coli T924_01]
 gb|ERC92027.1| hypothetical protein B233_4682 [Escherichia coli 2886-75]
 gb|ERC92120.1| hypothetical protein B233_4587 [Escherichia coli 2886-75]
 gb|ERC94611.1| hypothetical protein S1I_4939 [Escherichia coli B103]
 gb|ERC95152.1| hypothetical protein S1I_4700 [Escherichia coli B103]
 gb|ERC95305.1| hypothetical protein S35_4864 [Escherichia coli B104]
 gb|ERC95553.1| hypothetical protein S35_4769 [Escherichia coli B104]
 gb|ERD04973.1| hypothetical protein S35_0336 [Escherichia coli B104]
 gb|ERD05650.1| hypothetical protein S3C_4889 [Escherichia coli B105]
 gb|ERD07048.1| hypothetical protein S3C_4604 [Escherichia coli B105]
 gb|ERD08085.1| hypothetical protein S1I_0340 [Escherichia coli B103]
 gb|ERD09133.1| hypothetical protein B233_0337 [Escherichia coli 2886-75]
 gb|ERD20601.1| hypothetical protein S3C_0339 [Escherichia coli B105]
 gb|ERD24310.1| hypothetical protein S3G_5087 [Escherichia coli B112]
 gb|ERD24993.1| hypothetical protein S3G_4900 [Escherichia coli B112]
 gb|ERD25555.1| hypothetical protein S3G_4807 [Escherichia coli B112]
 gb|ERD28522.1| hypothetical protein S3I_4963 [Escherichia coli B113]
 gb|ERD28885.1| hypothetical protein S3I_4776 [Escherichia coli B113]
 gb|ERD29194.1| hypothetical protein S3I_4682 [Escherichia coli B113]
 gb|ERD36456.1| hypothetical protein S3K_5421 [Escherichia coli B114]
 gb|ERD37067.1| hypothetical protein S3G_0337 [Escherichia coli B112]
 gb|ERD37701.1| hypothetical protein S3K_4958 [Escherichia coli B114]
 gb|ERD37894.1| hypothetical protein S3K_4818 [Escherichia coli B114]
 gb|ERD38135.1| hypothetical protein S3K_4724 [Escherichia coli B114]
 gb|ERD40710.1| hypothetical protein S1O_4727 [Escherichia coli B15]
 gb|ERD41382.1| hypothetical protein S1O_4595 [Escherichia coli B15]
 gb|ERD41690.1| hypothetical protein S1O_4502 [Escherichia coli B15]
 gb|ERD44292.1| hypothetical protein S3I_0322 [Escherichia coli B113]
 gb|ERD53921.1| hypothetical protein S1O_0204 [Escherichia coli B15]
 gb|ERD56483.1| hypothetical protein S17_4637 [Escherichia coli B40-2]
 gb|ERD59452.1| hypothetical protein S3A_4965 [Escherichia coli B49-2]
 gb|ERD60187.1| hypothetical protein S3A_4849 [Escherichia coli B49-2]
 gb|ERD60358.1| hypothetical protein S3A_4707 [Escherichia coli B49-2]
 gb|ERD68328.1| hypothetical protein S17_0339 [Escherichia coli B40-2]
 gb|ERD73120.1| hypothetical protein S3A_0340 [Escherichia coli B49-2]
 gb|ERD77093.1| hypothetical protein S1W_4865 [Escherichia coli B84]
 gb|ERD77723.1| hypothetical protein S1W_4724 [Escherichia coli B84]
 gb|ERD77864.1| hypothetical protein S1W_4629 [Escherichia coli B84]
 gb|ERD84244.1| hypothetical protein S1Y_4907 [Escherichia coli B85]
 gb|ERD84674.1| hypothetical protein S1Y_4765 [Escherichia coli B85]
 gb|ERD84778.1| hypothetical protein S1Y_4672 [Escherichia coli B85]
 gb|ERD91678.1| hypothetical protein S1W_0340 [Escherichia coli B84]
 gb|ERD92744.1| hypothetical protein S1W_5292 [Escherichia coli B84]
 gb|ERD97935.1| hypothetical protein S1Y_0343 [Escherichia coli B85]
 gb|ERE10434.1| hypothetical protein EC09BKT24447_5506 [Escherichia coli
           09BKT024447]
 gb|ERE11202.1| hypothetical protein EC09BKT24447_5040 [Escherichia coli
           09BKT024447]
 gb|ERE11463.1| hypothetical protein EC09BKT24447_4840 [Escherichia coli
           09BKT024447]
 gb|ERE21475.1| hypothetical protein EC09BKT24447_0408 [Escherichia coli
           09BKT024447]
 gb|ERE24911.1| hypothetical protein S1M_4806 [Escherichia coli B90]
 gb|ERE25248.1| hypothetical protein S1M_4666 [Escherichia coli B90]
 gb|ERE25367.1| hypothetical protein S1M_4573 [Escherichia coli B90]
 gb|ERE29970.1| hypothetical protein B232_4930 [Escherichia coli Tx1686]
 gb|ERE30403.1| hypothetical protein B232_4711 [Escherichia coli Tx1686]
 gb|ERE37472.1| hypothetical protein B231_5044 [Escherichia coli Tx3800]
 gb|ERE37823.1| hypothetical protein B231_4905 [Escherichia coli Tx3800]
 gb|ERE38117.1| hypothetical protein B231_4811 [Escherichia coli Tx3800]
 gb|ERE39281.1| hypothetical protein S1M_0322 [Escherichia coli B90]
 gb|ERE41923.1| hypothetical protein B232_0457 [Escherichia coli Tx1686]
 gb|ERE45275.1| hypothetical protein B231_0410 [Escherichia coli Tx3800]
 gb|ERH37850.1| hypothetical protein P381_16265 [Salmonella enterica subsp.
           enterica serovar Enteritidis str. 10-34587]
 gb|AGW11871.1| hypothetical protein LY180_21035 [Escherichia coli LY180]
 emb|CCU64448.1| hypothetical protein SA47_0215 [Salmonella enterica subsp. enterica
           serovar Agona str. 47.E.09]
 gb|AHA66635.1| hypothetical protein Asd1617_03808 [Shigella dysenteriae 1617]
 gb|AHA67400.1| hypothetical protein Asd1617_04573 [Shigella dysenteriae 1617]
 gb|AHA67736.1| hypothetical protein Asd1617_04909 [Shigella dysenteriae 1617]
 gb|AHA67777.1| hypothetical protein Asd1617_04950 [Shigella dysenteriae 1617]
 gb|AHA67944.1| hypothetical protein Asd1617_05117 [Shigella dysenteriae 1617]
 gb|AHA68048.1| hypothetical protein Asd1617_05221 [Shigella dysenteriae 1617]
 gb|ESU81757.1| hypothetical protein WRSd5_02924 [Shigella dysenteriae WRSd5]
 gb|EUC89877.1| hypothetical protein HMPREF1569_0493 [Klebsiella oxytoca OK-1]
 gb|EYD79181.1| hypothetical protein AB98_4668 [Escherichia coli 1-176-05_S3_C1]
 gb|EYD79544.1| hypothetical protein AB98_4534 [Escherichia coli 1-176-05_S3_C1]
 gb|EYD79632.1| hypothetical protein AB98_4512 [Escherichia coli 1-176-05_S3_C1]
 gb|EYD79766.1| hypothetical protein AB98_4416 [Escherichia coli 1-176-05_S3_C1]
 gb|EYD80949.1| hypothetical protein AB11_3635 [Escherichia coli 1-176-05_S1_C1]
 gb|EYD81010.1| hypothetical protein AC26_4096 [Escherichia coli 1-176-05_S3_C2]
 gb|EYD88006.1| hypothetical protein AC26_0240 [Escherichia coli 1-176-05_S3_C2]
 gb|EYD93273.1| hypothetical protein AB11_4954 [Escherichia coli 1-176-05_S1_C1]
 gb|EYE07317.1| hypothetical protein AD08_0182 [Escherichia coli 1-110-08_S4_C2]
 gb|EYE09592.1| hypothetical protein AC55_4992 [Escherichia coli 1-110-08_S3_C3]
 gb|EYE10173.1| hypothetical protein AC55_4787 [Escherichia coli 1-110-08_S3_C3]
 gb|EYE18430.1| hypothetical protein AC25_4003 [Escherichia coli 1-110-08_S3_C2]
 gb|EYE19901.1| hypothetical protein AB69_3566 [Escherichia coli 1-110-08_S1_C3]
 gb|EYE20691.1| hypothetical protein AB97_4051 [Escherichia coli 1-110-08_S3_C1]
 gb|EYE30542.1| hypothetical protein AB97_0364 [Escherichia coli 1-110-08_S3_C1]
 gb|EYE31226.1| hypothetical protein AB38_4951 [Escherichia coli 1-110-08_S1_C2]
 gb|EYE32928.1| hypothetical protein AB38_4293 [Escherichia coli 1-110-08_S1_C2]
 gb|EYE33243.1| hypothetical protein AB38_4159 [Escherichia coli 1-110-08_S1_C2]
 gb|EYE33338.1| hypothetical protein AB38_4157 [Escherichia coli 1-110-08_S1_C2]
 gb|EYE33561.1| hypothetical protein AB38_4049 [Escherichia coli 1-110-08_S1_C2]
 gb|EYE40494.1| hypothetical protein AB38_0202 [Escherichia coli 1-110-08_S1_C2]
 gb|EYR75956.1| hypothetical protein I654_10770 [Salmonella enterica subsp.
           enterica serovar Aqua str. NVSL2001]
 gb|EZJ17682.1| hypothetical protein AD39_3816 [Escherichia coli 1-182-04_S4_C3]
 gb|EZJ36506.1| hypothetical protein AD11_2950 [Escherichia coli 1-250-04_S4_C2]
 gb|EZJ46714.1| hypothetical protein AD10_0204 [Escherichia coli 1-182-04_S4_C2]
 gb|EZJ60255.1| hypothetical protein AC82_2803 [Escherichia coli 1-182-04_S4_C1]
 gb|EZJ66226.1| hypothetical protein AC81_4329 [Escherichia coli 1-176-05_S4_C1]
 gb|EZJ67472.1| hypothetical protein AC81_3724 [Escherichia coli 1-176-05_S4_C1]
 gb|EZJ79687.1| hypothetical protein AC27_4077 [Escherichia coli 1-182-04_S3_C2]
 gb|EZJ79754.1| hypothetical protein AC27_4040 [Escherichia coli 1-182-04_S3_C2]
 gb|EZJ79978.1| hypothetical protein AC56_0197 [Escherichia coli 1-182-04_S3_C3]
 gb|EZJ79989.1| hypothetical protein AC27_3918 [Escherichia coli 1-182-04_S3_C2]
 gb|EZJ80191.1| hypothetical protein AC27_3822 [Escherichia coli 1-182-04_S3_C2]
 gb|EZJ82012.1| hypothetical protein AC00_4271 [Escherichia coli 1-250-04_S3_C1]
 gb|EZJ91733.1| hypothetical protein AB71_4712 [Escherichia coli 1-182-04_S1_C3]
 gb|EZJ91856.1| hypothetical protein AB71_4670 [Escherichia coli 1-182-04_S1_C3]
 gb|EZJ92167.1| hypothetical protein AB71_4542 [Escherichia coli 1-182-04_S1_C3]
 gb|EZJ99851.1| hypothetical protein AB71_0428 [Escherichia coli 1-182-04_S1_C3]
 gb|EZK02446.1| hypothetical protein AB72_0215 [Escherichia coli 1-250-04_S1_C3]
 gb|EZK05256.1| hypothetical protein AB70_4368 [Escherichia coli 1-176-05_S1_C3]
 gb|EZK05394.1| hypothetical protein AB70_4279 [Escherichia coli 1-176-05_S1_C3]
 gb|EZK10905.1| hypothetical protein AB70_0195 [Escherichia coli 1-176-05_S1_C3]
 gb|EZK17765.1| hypothetical protein AB26_4230 [Escherichia coli 2-011-08_S1_C2]
 gb|EZK24949.1| hypothetical protein AB39_0203 [Escherichia coli 1-176-05_S1_C2]
 gb|EZK25792.1| hypothetical protein AB12_4590 [Escherichia coli 1-182-04_S1_C1]
 gb|EZK26356.1| hypothetical protein AB12_4578 [Escherichia coli 1-182-04_S1_C1]
 gb|EZK26673.1| hypothetical protein AB12_4447 [Escherichia coli 1-182-04_S1_C1]
 gb|EZK27681.1| hypothetical protein AB25_4417 [Escherichia coli 2-005-03_S1_C2]
 gb|EZK28004.1| hypothetical protein AB12_3796 [Escherichia coli 1-182-04_S1_C1]
 gb|EZK33670.1| hypothetical protein AB12_0238 [Escherichia coli 1-182-04_S1_C1]
 gb|EZK35647.1| hypothetical protein AB12_5175 [Escherichia coli 1-182-04_S1_C1]
 gb|EZK35761.1| hypothetical protein AB12_5161 [Escherichia coli 1-182-04_S1_C1]
 gb|KDA55433.1| hypothetical protein AA98_4641 [Escherichia coli 2-011-08_S1_C1]
 gb|KDA55522.1| hypothetical protein AA98_4635 [Escherichia coli 2-011-08_S1_C1]
 gb|KDA55524.1| hypothetical protein AA98_4486 [Escherichia coli 2-011-08_S1_C1]
 gb|KDA55763.1| hypothetical protein AA98_4364 [Escherichia coli 2-011-08_S1_C1]
 gb|KDA66250.1| hypothetical protein AB40_4430 [Escherichia coli 1-182-04_S1_C2]
 gb|KDA67099.1| hypothetical protein AB40_3748 [Escherichia coli 1-182-04_S1_C2]
 gb|KDA77323.1| hypothetical protein AC13_4413 [Escherichia coli 2-011-08_S3_C2]
 gb|KDA78090.1| hypothetical protein AC13_3616 [Escherichia coli 2-011-08_S3_C2]
 gb|KDS95379.1| hypothetical protein AB83_4609 [Escherichia coli 2-011-08_S3_C1]
 gb|KDS95656.1| hypothetical protein AB83_4433 [Escherichia coli 2-011-08_S3_C1]
 gb|KDT01044.1| hypothetical protein AC66_4037 [Escherichia coli 2-011-08_S4_C1]
 gb|KDT03550.1| hypothetical protein AC66_3486 [Escherichia coli 2-011-08_S4_C1]
 gb|KDT04904.1| hypothetical protein AB83_0200 [Escherichia coli 2-011-08_S3_C1]
 gb|KDT09713.1| hypothetical protein AB55_4564 [Escherichia coli 2-052-05_S1_C3]
 gb|KDT10036.1| hypothetical protein AB55_4552 [Escherichia coli 2-052-05_S1_C3]
 gb|KDT10049.1| hypothetical protein AB55_4548 [Escherichia coli 2-052-05_S1_C3]
 gb|KDT10240.1| hypothetical protein AB55_4359 [Escherichia coli 2-052-05_S1_C3]
 gb|KDT10277.1| hypothetical protein AB55_4266 [Escherichia coli 2-052-05_S1_C3]
 gb|KDT13448.1| hypothetical protein AD24_4109 [Escherichia coli 2-011-08_S4_C3]
 gb|KDT18678.1| hypothetical protein AD24_2740 [Escherichia coli 2-011-08_S4_C3]
 gb|KDT40694.1| hypothetical protein AC32_5231 [Escherichia coli 3-105-05_S3_C2]
 gb|KDT41344.1| hypothetical protein AD43_5318 [Escherichia coli 3-105-05_S4_C3]
 gb|KDT53352.1| hypothetical protein AC05_5273 [Escherichia coli 3-267-03_S3_C1]
 gb|KDT53635.1| hypothetical protein AC05_5252 [Escherichia coli 3-267-03_S3_C1]
 gb|KDT66973.1| hypothetical protein AC59_4946 [Escherichia coli 3-373-03_S3_C3]
 gb|KDT69454.1| hypothetical protein AB47_5253 [Escherichia coli 3-373-03_S1_C2]
 gb|KDT90496.1| hypothetical protein AC33_4866 [Escherichia coli 3-267-03_S3_C2]
 gb|KDT91189.1| hypothetical protein AC33_4843 [Escherichia coli 3-267-03_S3_C2]
 gb|KDT93717.1| hypothetical protein AB46_5122 [Escherichia coli 3-267-03_S1_C2]
 gb|KDU06783.1| hypothetical protein AC34_4793 [Escherichia coli 3-373-03_S3_C2]
 gb|KDU17056.1| hypothetical protein AD16_5603 [Escherichia coli 3-267-03_S4_C2]
 gb|KDU29506.1| hypothetical protein AC86_5406 [Escherichia coli 3-073-06_S4_C1]
 gb|KDU31255.1| hypothetical protein AC86_5224 [Escherichia coli 3-073-06_S4_C1]
 gb|KDU33411.1| hypothetical protein AC86_4956 [Escherichia coli 3-073-06_S4_C1]
 gb|KDU34058.1| hypothetical protein AB19_5246 [Escherichia coli 3-373-03_S1_C1]
 gb|KDU43835.1| hypothetical protein AC89_5643 [Escherichia coli 3-373-03_S4_C1]
 gb|KDU54203.1| hypothetical protein AD18_3630 [Escherichia coli 3-475-03_S4_C2]
 gb|KDV77613.1| hypothetical protein AC95_4464 [Escherichia coli 2-052-05_S4_C2]
 gb|KDV78333.1| hypothetical protein AC95_4426 [Escherichia coli 2-052-05_S4_C2]
 gb|KDV78647.1| hypothetical protein AC95_4259 [Escherichia coli 2-052-05_S4_C2]
 gb|KDV78703.1| hypothetical protein AC95_4167 [Escherichia coli 2-052-05_S4_C2]
 gb|KDV80114.1| hypothetical protein AC95_3649 [Escherichia coli 2-052-05_S4_C2]
 gb|KDV89918.1| hypothetical protein AB00_5140 [Raoultella ornithinolytica
           2-156-04_S1_C1]
 gb|KDV90112.1| hypothetical protein AB00_5041 [Raoultella ornithinolytica
           2-156-04_S1_C1]
 gb|KDV90372.1| hypothetical protein AB00_5032 [Raoultella ornithinolytica
           2-156-04_S1_C1]
 gb|KDV90417.1| hypothetical protein AB00_4942 [Raoultella ornithinolytica
           2-156-04_S1_C1]
 gb|KDV91270.1| hypothetical protein AB00_4433 [Raoultella ornithinolytica
           2-156-04_S1_C1]
 gb|KDV94783.1| hypothetical protein AB60_5020 [Escherichia coli 2-156-04_S1_C3]
 gb|KDV96352.1| hypothetical protein AB00_0358 [Raoultella ornithinolytica
           2-156-04_S1_C1]
 gb|KDV97646.1| hypothetical protein AB60_4466 [Escherichia coli 2-156-04_S1_C3]
 gb|KDV97723.1| hypothetical protein AB60_4430 [Escherichia coli 2-156-04_S1_C3]
 gb|KDV97977.1| hypothetical protein AB60_4298 [Escherichia coli 2-156-04_S1_C3]
 gb|KDV98065.1| hypothetical protein AB60_4207 [Escherichia coli 2-156-04_S1_C3]
 gb|KDW06059.1| hypothetical protein AC43_3645 [Escherichia coli 2-156-04_S3_C3]
 gb|KDW11151.1| hypothetical protein AB60_0179 [Escherichia coli 2-156-04_S1_C3]
 gb|KDW15997.1| hypothetical protein AB86_2906 [Escherichia coli 2-177-06_S3_C1]
 gb|KDW19173.1| hypothetical protein AC68_2851 [Escherichia coli 2-156-04_S4_C1]
 gb|KDW22923.1| hypothetical protein AB86_0223 [Escherichia coli 2-177-06_S3_C1]
 gb|KDW27352.1| hypothetical protein AC15_4481 [Escherichia coli 2-156-04_S3_C2]
 gb|KDW27680.1| hypothetical protein AC15_4479 [Escherichia coli 2-156-04_S3_C2]
 gb|KDW34976.1| hypothetical protein AC15_0235 [Escherichia coli 2-156-04_S3_C2]
 gb|KDW36929.1| hypothetical protein AB61_4566 [Escherichia coli 2-177-06_S1_C3]
 gb|KDW36938.1| hypothetical protein AB61_4557 [Escherichia coli 2-177-06_S1_C3]
 gb|KDW37285.1| hypothetical protein AB61_4428 [Escherichia coli 2-177-06_S1_C3]
 gb|KDW37415.1| hypothetical protein AB61_4333 [Escherichia coli 2-177-06_S1_C3]
 gb|KDW37925.1| hypothetical protein AC97_5060 [Escherichia coli 2-177-06_S4_C2]
 gb|KDW43691.1| hypothetical protein AB61_0824 [Escherichia coli 2-177-06_S1_C3]
 gb|KDW48062.1| hypothetical protein AC29_4972 [Escherichia coli 1-392-07_S3_C2]
 gb|KDW48410.1| hypothetical protein AC29_4894 [Escherichia coli 1-392-07_S3_C2]
 gb|KDW49882.1| hypothetical protein AB82_5208 [Escherichia coli 2-005-03_S3_C1]
 gb|KDW50941.1| hypothetical protein AB82_5024 [Escherichia coli 2-005-03_S3_C1]
 gb|KDW52161.1| hypothetical protein AB62_1842 [Escherichia coli 2-210-07_S1_C3]
 gb|KDW52775.1| hypothetical protein AB62_1291 [Escherichia coli 2-210-07_S1_C3]
 gb|KDW54936.1| hypothetical protein AB82_4301 [Escherichia coli 2-005-03_S3_C1]
 gb|KDW57965.1| hypothetical protein AC29_2706 [Escherichia coli 1-392-07_S3_C2]
 gb|KDW61671.1| hypothetical protein AC29_1351 [Escherichia coli 1-392-07_S3_C2]
 gb|KDW62676.1| hypothetical protein AC40_5295 [Escherichia coli 2-005-03_S3_C3]
 gb|KDW63529.1| hypothetical protein AC40_5016 [Escherichia coli 2-005-03_S3_C3]
 gb|KDW64293.1| hypothetical protein AC40_4339 [Escherichia coli 2-005-03_S3_C3]
 gb|KDW66685.1| hypothetical protein AC65_5293 [Escherichia coli 2-005-03_S4_C1]
 gb|KDW70711.1| hypothetical protein AB42_5623 [Escherichia coli 1-392-07_S1_C2]
 gb|KDW77885.1| hypothetical protein AC65_2140 [Escherichia coli 2-005-03_S4_C1]
 gb|KDW78412.1| hypothetical protein AC65_1722 [Escherichia coli 2-005-03_S4_C1]
 gb|KDW85064.1| hypothetical protein AB30_5016 [Escherichia coli 2-210-07_S1_C2]
 gb|KDW94519.1| hypothetical protein AB30_0794 [Escherichia coli 2-210-07_S1_C2]
 gb|KDW95232.1| hypothetical protein AC17_4875 [Escherichia coli 2-210-07_S3_C2]
 gb|KDW95239.1| hypothetical protein AC17_4863 [Escherichia coli 2-210-07_S3_C2]
 gb|KDW96434.1| hypothetical protein AC01_4695 [Escherichia coli 1-392-07_S3_C1]
 gb|KDW97001.1| hypothetical protein AC17_3897 [Escherichia coli 2-210-07_S3_C2]
 gb|KDW98266.1| hypothetical protein AC17_2974 [Escherichia coli 2-210-07_S3_C2]
 gb|KDX03593.1| hypothetical protein AC01_2219 [Escherichia coli 1-392-07_S3_C1]
 gb|KDX09333.1| hypothetical protein AB28_5163 [Raoultella ornithinolytica
           2-156-04_S1_C2]
 gb|KDX10241.1| hypothetical protein AB28_4566 [Raoultella ornithinolytica
           2-156-04_S1_C2]
 gb|KDX11978.1| hypothetical protein AC45_5789 [Escherichia coli 2-210-07_S3_C3]
 gb|KDX16441.1| hypothetical protein AB28_0361 [Raoultella ornithinolytica
           2-156-04_S1_C2]
 gb|KDX16820.1| hypothetical protein AC45_5594 [Escherichia coli 2-210-07_S3_C3]
 gb|KDX21868.1| hypothetical protein AC45_0229 [Escherichia coli 2-210-07_S3_C3]
 gb|KDX23859.1| hypothetical protein AC96_3687 [Escherichia coli 2-156-04_S4_C2]
 gb|KDX38831.1| hypothetical protein AC96_5141 [Escherichia coli 2-156-04_S4_C2]
 gb|KDX47429.1| hypothetical protein AD26_0192 [Escherichia coli 2-156-04_S4_C3]
 gb|KDX53819.1| hypothetical protein AD28_5092 [Escherichia coli 2-210-07_S4_C3]
 gb|KDX58481.1| hypothetical protein AD28_4894 [Escherichia coli 2-210-07_S4_C3]
 gb|KDX59273.1| hypothetical protein AD28_4807 [Escherichia coli 2-210-07_S4_C3]
 gb|KDX60763.1| hypothetical protein AB02_5000 [Escherichia coli 2-222-05_S1_C1]
 gb|KDX67307.1| hypothetical protein AB31_4976 [Escherichia coli 2-222-05_S1_C2]
 gb|KDX84651.1| hypothetical protein AB89_5025 [Escherichia coli 2-316-03_S3_C1]
 gb|KDX85574.1| hypothetical protein AC99_4460 [Escherichia coli 2-222-05_S4_C2]
 gb|KDX86711.1| hypothetical protein AB89_4873 [Escherichia coli 2-316-03_S3_C1]
 gb|KDX91697.1| hypothetical protein AB89_4193 [Escherichia coli 2-316-03_S3_C1]
 gb|KDX91726.1| hypothetical protein AC99_2092 [Escherichia coli 2-222-05_S4_C2]
 gb|KDX92020.1| hypothetical protein AB89_4113 [Escherichia coli 2-316-03_S3_C1]
 gb|KDX92903.1| hypothetical protein AB89_3807 [Escherichia coli 2-316-03_S3_C1]
 gb|KDX94278.1| hypothetical protein AC19_4919 [Escherichia coli 2-316-03_S3_C2]
 gb|KDX99410.1| hypothetical protein AC72_5293 [Escherichia coli 2-316-03_S4_C1]
 gb|KDY01351.1| hypothetical protein AC72_5223 [Escherichia coli 2-316-03_S4_C1]
 gb|KDY08054.1| hypothetical protein AC72_4743 [Escherichia coli 2-316-03_S4_C1]
 gb|KDY12756.1| hypothetical protein AD30_5336 [Escherichia coli 2-316-03_S4_C3]
 gb|KDY14126.1| hypothetical protein AB33_4766 [Escherichia coli 2-427-07_S1_C2]
 gb|KDY14656.1| hypothetical protein AB33_4751 [Escherichia coli 2-427-07_S1_C2]
 gb|KDY17479.1| hypothetical protein AD30_3106 [Escherichia coli 2-316-03_S4_C3]
 gb|KDY23253.1| hypothetical protein AB90_5296 [Escherichia coli 2-427-07_S3_C1]
 gb|KDY24870.1| hypothetical protein AB90_5248 [Escherichia coli 2-427-07_S3_C1]
 gb|KDY24872.1| hypothetical protein AB90_5247 [Escherichia coli 2-427-07_S3_C1]
 gb|KDY38439.1| hypothetical protein AB91_5864 [Escherichia coli 2-460-02_S3_C1]
 gb|KDY38635.1| hypothetical protein AD01_5599 [Escherichia coli 2-427-07_S4_C2]
 gb|KDY38990.1| hypothetical protein AD01_5497 [Escherichia coli 2-427-07_S4_C2]
 gb|KDY42659.1| hypothetical protein AD01_3682 [Escherichia coli 2-427-07_S4_C2]
 gb|KDY45814.1| hypothetical protein AD01_1697 [Escherichia coli 2-427-07_S4_C2]
 gb|KDY50628.1| hypothetical protein AC49_5770 [Escherichia coli 2-460-02_S3_C3]
 gb|KDY51201.1| hypothetical protein AC49_5722 [Escherichia coli 2-460-02_S3_C3]
 gb|KDY51597.1| hypothetical protein AC20_5750 [Escherichia coli 2-460-02_S3_C2]
 gb|KDY55692.1| hypothetical protein AC49_5316 [Escherichia coli 2-460-02_S3_C3]
 gb|KDY57930.1| hypothetical protein AC49_4403 [Escherichia coli 2-460-02_S3_C3]
 gb|KDY62009.1| hypothetical protein AC49_2872 [Escherichia coli 2-460-02_S3_C3]
 gb|KDY66307.1| hypothetical protein AD32_5667 [Escherichia coli 2-460-02_S4_C3]
 gb|KDY69465.1| hypothetical protein AB06_5300 [Escherichia coli 2-474-04_S1_C1]
 gb|KDY70821.1| hypothetical protein AB06_5253 [Escherichia coli 2-474-04_S1_C1]
 gb|KDY72609.1| hypothetical protein AB92_5993 [Escherichia coli 2-474-04_S3_C1]
 gb|KDY74488.1| hypothetical protein AB92_5898 [Escherichia coli 2-474-04_S3_C1]
 gb|KDY83482.1| hypothetical protein AB64_5302 [Escherichia coli 2-427-07_S1_C3]
 gb|KDY98172.1| hypothetical protein AB35_4830 [Escherichia coli 2-474-04_S1_C2]
 gb|KDY98175.1| hypothetical protein AB35_4828 [Escherichia coli 2-474-04_S1_C2]
 gb|KDZ00167.1| hypothetical protein AD03_4922 [Escherichia coli 2-474-04_S4_C2]
 gb|KDZ02117.1| hypothetical protein AD03_4423 [Escherichia coli 2-474-04_S4_C2]
 gb|KDZ06670.1| hypothetical protein AD03_2373 [Escherichia coli 2-474-04_S4_C2]
 gb|KDZ16735.1| hypothetical protein AB15_4955 [Escherichia coli 3-020-07_S1_C1]
 gb|KDZ18895.1| hypothetical protein AC50_0824 [Escherichia coli 2-474-04_S3_C3]
 gb|KDZ21676.1| hypothetical protein AB73_5161 [Escherichia coli 3-020-07_S1_C3]
 gb|KDZ23395.1| hypothetical protein AB73_5131 [Escherichia coli 3-020-07_S1_C3]
 gb|KDZ43028.1| hypothetical protein AD41_5178 [Escherichia coli 3-020-07_S4_C3]
 gb|KDZ51768.1| hypothetical protein AD41_1798 [Escherichia coli 3-020-07_S4_C3]
 gb|KDZ53499.1| hypothetical protein AD41_0961 [Escherichia coli 3-020-07_S4_C3]
 gb|KDZ54197.1| hypothetical protein AD41_0667 [Escherichia coli 3-020-07_S4_C3]
 gb|KDZ72181.1| hypothetical protein AB45_5253 [Escherichia coli 3-105-05_S1_C2]
 gb|KDZ72179.1| hypothetical protein AD14_4731 [Escherichia coli 3-073-06_S4_C2]
 gb|KDZ72215.1| hypothetical protein AD14_4696 [Escherichia coli 3-073-06_S4_C2]
 gb|KDZ78148.1| hypothetical protein AD42_4943 [Escherichia coli 3-073-06_S4_C3]
 gb|KDZ78683.1| hypothetical protein AD42_4667 [Escherichia coli 3-073-06_S4_C3]
 gb|KDZ81102.1| hypothetical protein AD42_3373 [Escherichia coli 3-073-06_S4_C3]
 gb|KDZ89125.1| hypothetical protein AB04_4684 [Escherichia coli 2-427-07_S1_C1]
 gb|KDZ89282.1| hypothetical protein AB04_4678 [Escherichia coli 2-427-07_S1_C1]
 gb|KDZ89510.1| hypothetical protein AB04_4663 [Escherichia coli 2-427-07_S1_C1]
 gb|KDZ89553.1| hypothetical protein AB04_4658 [Escherichia coli 2-427-07_S1_C1]
 gb|KEJ05053.1| hypothetical protein AB50_4614 [Escherichia coli 6-175-07_S1_C2]
 gb|KEJ06653.1| hypothetical protein AB50_4330 [Escherichia coli 6-175-07_S1_C2]
 gb|KEJ18885.1| hypothetical protein AB50_0290 [Escherichia coli 6-175-07_S1_C2]
 gb|KEJ23867.1| hypothetical protein AB32_4003 [Escherichia coli 2-316-03_S1_C2]
 gb|KEJ73496.1| hypothetical protein AC37_4940 [Escherichia coli 6-175-07_S3_C2]
 gb|KEJ73789.1| hypothetical protein AC37_4897 [Escherichia coli 6-175-07_S3_C2]
 gb|KEJ73866.1| hypothetical protein AC37_4891 [Escherichia coli 6-175-07_S3_C2]
 gb|KEJ73876.1| hypothetical protein AC37_4731 [Escherichia coli 6-175-07_S3_C2]
 gb|KEJ81560.1| hypothetical protein AC37_0256 [Escherichia coli 6-175-07_S3_C2]
 gb|KEK77455.1| hypothetical protein AC35_5294 [Escherichia coli 3-475-03_S3_C2]
 gb|KEK80893.1| hypothetical protein AC35_5063 [Escherichia coli 3-475-03_S3_C2]
 gb|KEK85805.1| hypothetical protein AC35_3809 [Escherichia coli 3-475-03_S3_C2]
 gb|KEK86229.1| hypothetical protein AC35_3395 [Escherichia coli 3-475-03_S3_C2]
 gb|KEK88726.1| hypothetical protein AB49_5240 [Escherichia coli 4-203-08_S1_C2]
 gb|KEK90608.1| hypothetical protein AC61_4743 [Escherichia coli 4-203-08_S3_C3]
 gb|KEK92211.1| hypothetical protein AB78_4685 [Escherichia coli 4-203-08_S1_C3]
 gb|KEL05383.1| hypothetical protein AC36_4790 [Escherichia coli 4-203-08_S3_C2]
 gb|KEL09662.1| hypothetical protein AC08_4546 [Escherichia coli 4-203-08_S3_C1]
 gb|KEL18118.1| hypothetical protein AC08_1733 [Escherichia coli 4-203-08_S3_C1]
 gb|KEL20764.1| hypothetical protein AD04_5016 [Escherichia coli 5-172-05_S4_C2]
 gb|KEL29630.1| hypothetical protein AC51_5514 [Escherichia coli 5-172-05_S3_C3]
 gb|KEL31714.1| hypothetical protein AD05_3996 [Escherichia coli 5-366-08_S4_C2]
 gb|KEL35555.1| hypothetical protein AD05_0399 [Escherichia coli 5-366-08_S4_C2]
 gb|KEL36366.1| hypothetical protein AC51_5163 [Escherichia coli 5-172-05_S3_C3]
 gb|KEL37021.1| hypothetical protein AC51_5060 [Escherichia coli 5-172-05_S3_C3]
 gb|KEL42762.1| hypothetical protein AC51_3472 [Escherichia coli 5-172-05_S3_C3]
 gb|KEL43701.1| hypothetical protein AB22_5042 [Escherichia coli 6-175-07_S1_C1]
 gb|KEL44035.1| hypothetical protein AC51_2310 [Escherichia coli 5-172-05_S3_C3]
 gb|KEL47932.1| hypothetical protein AB22_4172 [Escherichia coli 6-175-07_S1_C1]
 gb|KEL48021.1| hypothetical protein AB22_4094 [Escherichia coli 6-175-07_S1_C1]
 gb|KEL52756.1| hypothetical protein AB66_4880 [Escherichia coli 5-172-05_S1_C3]
 gb|KEL72359.1| hypothetical protein AC22_5555 [Escherichia coli 5-366-08_S3_C2]
 gb|KEL72462.1| hypothetical protein AC52_4259 [Escherichia coli 5-366-08_S3_C3]
 gb|KEL73240.1| hypothetical protein AC52_3482 [Escherichia coli 5-366-08_S3_C3]
 gb|KEL73419.1| hypothetical protein AC52_3309 [Escherichia coli 5-366-08_S3_C3]
 gb|KEL73875.1| hypothetical protein AC52_2801 [Escherichia coli 5-366-08_S3_C3]
 gb|KEL91857.1| hypothetical protein AC09_2895 [Escherichia coli 6-175-07_S3_C1]
 gb|KEM00574.1| hypothetical protein AC62_3069 [Escherichia coli 6-175-07_S3_C3]
 gb|KEM01886.1| hypothetical protein AC91_4303 [Escherichia coli 6-175-07_S4_C1]
 gb|KEM01941.1| hypothetical protein AC91_4178 [Escherichia coli 6-175-07_S4_C1]
 gb|KEM04555.1| hypothetical protein AC91_3521 [Escherichia coli 6-175-07_S4_C1]
 gb|KEM06017.1| hypothetical protein AD20_2732 [Escherichia coli 6-175-07_S4_C2]
 gb|KEM20473.1| hypothetical protein AC10_3027 [Escherichia coli 6-319-05_S3_C1]
 gb|KEM29747.1| hypothetical protein AD21_3686 [Escherichia coli 6-319-05_S4_C2]
 gb|KEM34377.1| hypothetical protein AC38_0327 [Escherichia coli 6-319-05_S3_C2]
 gb|KEM36870.1| hypothetical protein AB24_4709 [Escherichia coli 6-537-08_S1_C1]
 gb|KEM37137.1| hypothetical protein AB24_4667 [Escherichia coli 6-537-08_S1_C1]
 gb|KEM37314.1| hypothetical protein AB24_4496 [Escherichia coli 6-537-08_S1_C1]
 gb|KEM37460.1| hypothetical protein AB24_4405 [Escherichia coli 6-537-08_S1_C1]
 gb|KEM43829.1| hypothetical protein AB24_0251 [Escherichia coli 6-537-08_S1_C1]
 gb|KEM45338.1| hypothetical protein AD46_4313 [Escherichia coli 6-175-07_S4_C3]
 gb|KEM50908.1| hypothetical protein AB79_3853 [Escherichia coli 6-175-07_S1_C3]
 gb|KEM51507.1| hypothetical protein AD46_0195 [Escherichia coli 6-175-07_S4_C3]
 gb|KEM60675.1| hypothetical protein AC63_2962 [Escherichia coli 6-319-05_S3_C3]
 gb|KEM68664.1| hypothetical protein AC11_5181 [Escherichia coli 6-537-08_S3_C1]
 gb|KEM70384.1| hypothetical protein AC11_4873 [Escherichia coli 6-537-08_S3_C1]
 gb|KEM71872.1| hypothetical protein AC11_4448 [Escherichia coli 6-537-08_S3_C1]
 gb|KEM72084.1| hypothetical protein AC11_4406 [Escherichia coli 6-537-08_S3_C1]
 gb|KEM72364.1| hypothetical protein AC11_4269 [Escherichia coli 6-537-08_S3_C1]
 gb|KEM74352.1| hypothetical protein AC11_3666 [Escherichia coli 6-537-08_S3_C1]
 gb|KEM77218.1| hypothetical protein AC64_5117 [Escherichia coli 6-537-08_S3_C3]
 gb|KEM77821.1| hypothetical protein AC64_5101 [Escherichia coli 6-537-08_S3_C3]
 gb|KEM80080.1| hypothetical protein AC64_4482 [Escherichia coli 6-537-08_S3_C3]
 gb|KEM80332.1| hypothetical protein AC64_4440 [Escherichia coli 6-537-08_S3_C3]
 gb|KEM80721.1| hypothetical protein AC64_4311 [Escherichia coli 6-537-08_S3_C3]
 gb|KEM80984.1| hypothetical protein AC11_0194 [Escherichia coli 6-537-08_S3_C1]
 gb|KEM81843.1| hypothetical protein AC64_3689 [Escherichia coli 6-537-08_S3_C3]
 gb|KEM82759.1| hypothetical protein AC64_2927 [Escherichia coli 6-537-08_S3_C3]
 gb|KEM86227.1| hypothetical protein AC64_0193 [Escherichia coli 6-537-08_S3_C3]
 gb|KEM87851.1| hypothetical protein AC71_3428 [Escherichia coli 2-222-05_S4_C1]
 gb|KEM95167.1| hypothetical protein AC71_0191 [Escherichia coli 2-222-05_S4_C1]
 gb|KEM95671.1| hypothetical protein AC92_0186 [Escherichia coli 6-537-08_S4_C1]
 gb|KEM97900.1| hypothetical protein AC53_4310 [Escherichia coli 7-233-03_S3_C3]
 gb|KEM98504.1| hypothetical protein AB68_3467 [Escherichia coli 7-233-03_S1_C3]
 gb|KEN13740.1| hypothetical protein AC39_4533 [Escherichia coli 6-537-08_S3_C2]
 gb|KEN13910.1| hypothetical protein AC39_4527 [Escherichia coli 6-537-08_S3_C2]
 gb|KEN14041.1| hypothetical protein AC39_4398 [Escherichia coli 6-537-08_S3_C2]
 gb|KEN14232.1| hypothetical protein AC39_4386 [Escherichia coli 6-537-08_S3_C2]
 gb|KEN19161.1| hypothetical protein AC23_4528 [Escherichia coli 7-233-03_S3_C2]
 gb|KEN19977.1| hypothetical protein AC23_4412 [Escherichia coli 7-233-03_S3_C2]
 gb|KEN20443.1| hypothetical protein AC23_4308 [Escherichia coli 7-233-03_S3_C2]
 gb|KEN22376.1| hypothetical protein AC39_0196 [Escherichia coli 6-537-08_S3_C2]
 gb|KEN28721.1| hypothetical protein AB09_0194 [Escherichia coli 8-415-05_S1_C1]
 gb|KEN29986.1| hypothetical protein AC23_0195 [Escherichia coli 7-233-03_S3_C2]
 gb|KEN40213.1| hypothetical protein AC78_3452 [Escherichia coli 7-233-03_S4_C1]
 gb|KEN50016.1| hypothetical protein AB81_4633 [Escherichia coli 6-537-08_S1_C3]
 gb|KEN50426.1| hypothetical protein AB81_4590 [Escherichia coli 6-537-08_S1_C3]
 gb|KEN50614.1| hypothetical protein AB81_4583 [Escherichia coli 6-537-08_S1_C3]
 gb|KEN51254.1| hypothetical protein AB81_4315 [Escherichia coli 6-537-08_S1_C3]
 gb|KEN58738.1| hypothetical protein AD22_4345 [Escherichia coli 6-537-08_S4_C2]
 gb|KEN59259.1| hypothetical protein AD22_4337 [Escherichia coli 6-537-08_S4_C2]
 gb|KEN59678.1| hypothetical protein AD22_4104 [Escherichia coli 6-537-08_S4_C2]
 gb|KEN60350.1| hypothetical protein AB81_0269 [Escherichia coli 6-537-08_S1_C3]
 gb|KEN61326.1| hypothetical protein AD22_3533 [Escherichia coli 6-537-08_S4_C2]
 gb|KEN62626.1| hypothetical protein AD40_4858 [Escherichia coli 1-392-07_S4_C3]
 gb|KEN62934.1| hypothetical protein AD40_4822 [Escherichia coli 1-392-07_S4_C3]
 gb|KEN63427.1| hypothetical protein AD40_4623 [Escherichia coli 1-392-07_S4_C3]
 gb|KEN67854.1| hypothetical protein AB81_5087 [Escherichia coli 6-537-08_S1_C3]
 gb|KEN71582.1| hypothetical protein AC14_4437 [Escherichia coli 2-052-05_S3_C2]
 gb|KEN72717.1| hypothetical protein AC14_4264 [Escherichia coli 2-052-05_S3_C2]
 gb|KEN72962.1| hypothetical protein AC14_4169 [Escherichia coli 2-052-05_S3_C2]
 gb|KEN75932.1| hypothetical protein AD40_0203 [Escherichia coli 1-392-07_S4_C3]
 gb|KEN80206.1| hypothetical protein AC14_0196 [Escherichia coli 2-052-05_S3_C2]
 gb|KEN82351.1| hypothetical protein AC75_4495 [Escherichia coli 2-474-04_S4_C1]
 gb|KEN82407.1| hypothetical protein AD40_5379 [Escherichia coli 1-392-07_S4_C3]
 gb|KEN83296.1| hypothetical protein AC75_3731 [Escherichia coli 2-474-04_S4_C1]
 gb|KEN87597.1| hypothetical protein AB88_3925 [Escherichia coli 2-222-05_S3_C1]
 gb|KEN88437.1| hypothetical protein AC75_0283 [Escherichia coli 2-474-04_S4_C1]
 gb|KEN98897.1| hypothetical protein AC84_3042 [Escherichia coli 1-392-07_S4_C1]
 gb|KEO07395.1| hypothetical protein AC44_4028 [Escherichia coli 2-177-06_S3_C3]
 gb|KEO16656.1| hypothetical protein AC44_0343 [Escherichia coli 2-177-06_S3_C3]
 gb|KEO26776.1| hypothetical protein AC28_4336 [Escherichia coli 1-250-04_S3_C2]
 emb|CEH23780.1| hypothetical protein SMA01_3989 [Salmonella enterica subsp.
           enterica serovar Manhattan str. 111113]
 emb|CTU25978.1| Uncharacterised protein [Escherichia coli]
 emb|CTY11579.1| Uncharacterised protein [Escherichia coli]
 gb|AML36874.1| Hypothetical protein EAG7_03130 [Klebsiella aerogenes]
 gb|AML37590.1| Hypothetical protein EAG7_03852 [Klebsiella aerogenes]
 gb|AML37625.1| Hypothetical protein EAG7_03888 [Klebsiella aerogenes]
 gb|AML37708.1| Hypothetical protein EAG7_03971 [Klebsiella aerogenes]
 gb|AML37789.1| Hypothetical protein EAG7_04052 [Klebsiella aerogenes]
 gb|AML38285.1| Hypothetical protein EAG7_04553 [Klebsiella aerogenes]
 gb|AMO46941.1| Hypothetical protein AKI40_0515 [Enterobacter sp. FY-07]
 gb|AMO47696.1| Hypothetical protein AKI40_1280 [Enterobacter sp. FY-07]
 gb|AMO50462.1| Hypothetical protein AKI40_4085 [Enterobacter sp. FY-07]
 gb|AMO51078.1| Hypothetical protein AKI40_4703 [Enterobacter sp. FY-07]
 gb|AMO51117.1| Hypothetical protein AKI40_4743 [Enterobacter sp. FY-07]
 gb|AMO51196.1| Hypothetical protein AKI40_4823 [Enterobacter sp. FY-07]
 gb|AMO51298.1| Hypothetical protein AKI40_4926 [Enterobacter sp. FY-07]
 gb|AOM43512.1| hypothetical protein FORC28_0520 [Escherichia coli]
 gb|AOM44353.1| hypothetical protein FORC28_1362 [Escherichia coli]
 gb|AOM47963.1| hypothetical protein FORC28_4987 [Escherichia coli]
 gb|AOM48721.1| hypothetical protein FORC28_5747 [Escherichia coli]
 gb|AOM48759.1| hypothetical protein FORC28_5785 [Escherichia coli]
 gb|AOM48909.1| hypothetical protein FORC28_5935 [Escherichia coli]
 gb|AOM49001.1| hypothetical protein FORC28_6027 [Escherichia coli]
 gb|OUF93107.1| hypothetical protein AZ030_002639 [Escherichia coli]
 gb|OXZ80575.1| hypothetical protein RW77_04156 [Escherichia coli]
          Length = 39

 Score = 84.7 bits (208), Expect = 3e-19
 Identities = 38/38 (100%), Positives = 38/38 (100%)
 Frame = -3

Query: 174 ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 61
           ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG
Sbjct: 2   ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 39


>gb|KLW05272.1| hypothetical protein SK45_03630, partial [Enterobacter cloacae]
          Length = 39

 Score = 84.7 bits (208), Expect = 3e-19
 Identities = 38/38 (100%), Positives = 38/38 (100%)
 Frame = -3

Query: 174 ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 61
           ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG
Sbjct: 2   ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 39


>gb|EQR69632.1| hypothetical protein G790_00051, partial [Escherichia coli HVH 132
           (4-6876862)]
 gb|EQS12378.1| hypothetical protein G802_04527, partial [Escherichia coli HVH 144
           (4-4451937)]
 gb|ERA71719.1| hypothetical protein G817_04843, partial [Escherichia coli HVH 159
           (4-5818141)]
 gb|OUF96149.1| hypothetical protein G97194_003078, partial [Escherichia coli]
          Length = 40

 Score = 84.7 bits (208), Expect = 3e-19
 Identities = 38/38 (100%), Positives = 38/38 (100%)
 Frame = -3

Query: 174 ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 61
           ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG
Sbjct: 3   ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 40


>gb|ELI34475.1| hypothetical protein WII_04366, partial [Escherichia coli KTE120]
 gb|EQQ55409.1| hypothetical protein G767_04199, partial [Escherichia coli HVH 106
           (4-6881831)]
 gb|OXZ48511.1| hypothetical protein RW70_03552, partial [Escherichia coli]
          Length = 40

 Score = 84.7 bits (208), Expect = 3e-19
 Identities = 38/38 (100%), Positives = 38/38 (100%)
 Frame = -3

Query: 174 ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 61
           ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG
Sbjct: 3   ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 40


>gb|KEM89333.1| hypothetical protein AC92_3539 [Escherichia coli 6-537-08_S4_C1]
          Length = 41

 Score = 84.7 bits (208), Expect = 3e-19
 Identities = 38/38 (100%), Positives = 38/38 (100%)
 Frame = -3

Query: 174 ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 61
           ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG
Sbjct: 4   ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 41


>gb|OUF02898.1| hypothetical protein AZZ94_003440, partial [Enterobacter cloacae]
          Length = 42

 Score = 84.7 bits (208), Expect = 3e-19
 Identities = 38/38 (100%), Positives = 38/38 (100%)
 Frame = -3

Query: 174 ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 61
           ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG
Sbjct: 5   ELKSVEDTSWLQLFIKNTALCKHESGRIRCDACPVPEG 42


Top