BLASTX nr result
ID: Astragalus23_contig00019496
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00019496 (501 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAT96785.1| hypothetical protein VIGAN_09008500 [Vigna angul... 57 8e-08 gb|OIW00454.1| hypothetical protein TanjilG_05804 [Lupinus angus... 59 4e-07 >dbj|BAT96785.1| hypothetical protein VIGAN_09008500 [Vigna angularis var. angularis] Length = 91 Score = 57.4 bits (137), Expect = 8e-08 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +1 Query: 250 KKNWNMTKQKTTIMSSTLSTQHELIKHECKVSPPSLIIIA 369 KK TK+KT IMSSTLS QHELIKHEC+V P SLI+IA Sbjct: 14 KKIEKRTKKKTGIMSSTLSMQHELIKHECRVFPSSLIVIA 53 >gb|OIW00454.1| hypothetical protein TanjilG_05804 [Lupinus angustifolius] Length = 574 Score = 58.9 bits (141), Expect(2) = 4e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 371 HAIMMRDGGDTLHSCLINSCCVLKVDDIIVV 279 +AIMMRDGG+TLHSCLINSCCV KVDDII++ Sbjct: 188 NAIMMRDGGNTLHSCLINSCCVPKVDDIILL 218 Score = 22.7 bits (47), Expect(2) = 4e-07 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 264 IPIFFPSRTS*NGDFTCTLI 205 IP F P S NG+F C L+ Sbjct: 223 IPNFLPLCLSYNGNFICVLM 242