BLASTX nr result
ID: Astragalus23_contig00019119
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00019119 (307 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004510478.1| PREDICTED: probable GTP diphosphokinase RSH2... 58 1e-07 >ref|XP_004510478.1| PREDICTED: probable GTP diphosphokinase RSH2, chloroplastic [Cicer arietinum] Length = 728 Score = 58.2 bits (139), Expect = 1e-07 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 3/37 (8%) Frame = -3 Query: 305 DKSLTEYREEIQRMYDQGLTAAA---PATASSMVGTS 204 DKSLTEYREEIQRMYD+GLT ++ PATASSMVGTS Sbjct: 692 DKSLTEYREEIQRMYDRGLTVSSMGTPATASSMVGTS 728