BLASTX nr result
ID: Astragalus23_contig00019097
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00019097 (367 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMP00130.1| JAB1/Mov34/MPN/PAD-1 [Corchorus olitorius] 59 9e-08 gb|OMO54275.1| JAB1/Mov34/MPN/PAD-1 [Corchorus capsularis] 59 1e-07 gb|AFK43309.1| unknown [Medicago truncatula] 58 1e-07 gb|KRH09766.1| hypothetical protein GLYMA_15G010400 [Glycine max] 59 2e-07 ref|NP_001240150.1| uncharacterized protein LOC100784991 [Glycin... 59 2e-07 gb|PNY10262.1| Mov34/MPN/PAD-1 family protein [Trifolium pratense] 59 2e-07 ref|XP_013465557.1| Mov34/MPN/PAD-1 family protein [Medicago tru... 58 3e-07 ref|XP_013465556.1| Mov34/MPN/PAD-1 family protein [Medicago tru... 58 3e-07 gb|KRH23554.1| hypothetical protein GLYMA_13G363400 [Glycine max] 58 3e-07 ref|XP_015868334.1| PREDICTED: lys-63-specific deubiquitinase BR... 58 3e-07 ref|XP_019457999.1| PREDICTED: lys-63-specific deubiquitinase BR... 58 3e-07 ref|XP_021298574.1| lys-63-specific deubiquitinase BRCC36-like [... 58 3e-07 ref|XP_007023913.2| PREDICTED: lys-63-specific deubiquitinase BR... 58 3e-07 gb|EOY26535.1| Mov34/MPN/PAD-1 family protein isoform 2 [Theobro... 58 3e-07 ref|XP_003543672.1| PREDICTED: lys-63-specific deubiquitinase BR... 58 3e-07 ref|XP_004486693.1| PREDICTED: lys-63-specific deubiquitinase BR... 58 3e-07 ref|XP_003597836.2| Mov34/MPN/PAD-1 family protein [Medicago tru... 58 3e-07 gb|EOY26534.1| Mov34/MPN/PAD-1 family protein isoform 1 [Theobro... 58 3e-07 ref|XP_022714854.1| lys-63-specific deubiquitinase BRCC36-like [... 57 5e-07 dbj|GAU11061.1| hypothetical protein TSUD_113550 [Trifolium subt... 57 5e-07 >gb|OMP00130.1| JAB1/Mov34/MPN/PAD-1 [Corchorus olitorius] Length = 360 Score = 59.3 bits (142), Expect = 9e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQ 4 SGA YV+KEIPLYVLP+SSL+NL+SPLLS+TDLQ Sbjct: 196 SGAEYVRKEIPLYVLPTSSLLNLDSPLLSFTDLQ 229 >gb|OMO54275.1| JAB1/Mov34/MPN/PAD-1 [Corchorus capsularis] Length = 434 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQ 4 SGA YV+KEIPLYVLP+SSL+NL+SPLLS+TDLQ Sbjct: 270 SGAEYVRKEIPLYVLPTSSLLNLDSPLLSFTDLQ 303 >gb|AFK43309.1| unknown [Medicago truncatula] Length = 192 Score = 57.8 bits (138), Expect = 1e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQH 1 SGA YV+KEIPL+VLPS S +NL+SPL SYTDLQH Sbjct: 19 SGAEYVRKEIPLHVLPSLSFINLDSPLSSYTDLQH 53 >gb|KRH09766.1| hypothetical protein GLYMA_15G010400 [Glycine max] Length = 323 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQH 1 SGA +V+KEIPLYVLP+ SL+NL+SPL SYTDLQH Sbjct: 270 SGAEFVRKEIPLYVLPALSLINLDSPLSSYTDLQH 304 >ref|NP_001240150.1| uncharacterized protein LOC100784991 [Glycine max] gb|ACU18325.1| unknown [Glycine max] gb|KHN22467.1| Lys-63-specific deubiquitinase BRCC36 [Glycine soja] gb|KRH09765.1| hypothetical protein GLYMA_15G010400 [Glycine max] Length = 436 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQH 1 SGA +V+KEIPLYVLP+ SL+NL+SPL SYTDLQH Sbjct: 270 SGAEFVRKEIPLYVLPALSLINLDSPLSSYTDLQH 304 >gb|PNY10262.1| Mov34/MPN/PAD-1 family protein [Trifolium pratense] Length = 470 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQH 1 SGA YV+KEIPLYV PS SL+NL++PL SYTDLQH Sbjct: 297 SGAEYVRKEIPLYVTPSMSLINLDTPLSSYTDLQH 331 >ref|XP_013465557.1| Mov34/MPN/PAD-1 family protein [Medicago truncatula] gb|KEH39592.1| Mov34/MPN/PAD-1 family protein [Medicago truncatula] Length = 350 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQH 1 SGA YV+KEIPL+VLPS S +NL+SPL SYTDLQH Sbjct: 270 SGAEYVRKEIPLHVLPSLSFINLDSPLSSYTDLQH 304 >ref|XP_013465556.1| Mov34/MPN/PAD-1 family protein [Medicago truncatula] gb|KEH39591.1| Mov34/MPN/PAD-1 family protein [Medicago truncatula] Length = 363 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQH 1 SGA YV+KEIPL+VLPS S +NL+SPL SYTDLQH Sbjct: 190 SGAEYVRKEIPLHVLPSLSFINLDSPLSSYTDLQH 224 >gb|KRH23554.1| hypothetical protein GLYMA_13G363400 [Glycine max] Length = 393 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQH 1 SGA +V+KEIPLYVLP+ SL+N++SPL SYTDLQH Sbjct: 270 SGAEFVRKEIPLYVLPALSLINIDSPLSSYTDLQH 304 >ref|XP_015868334.1| PREDICTED: lys-63-specific deubiquitinase BRCC36 [Ziziphus jujuba] Length = 420 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/35 (71%), Positives = 33/35 (94%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQH 1 SGA YV+KE+PL+VLP+SSL+ L+SPL+S+TDLQH Sbjct: 321 SGAEYVRKEVPLHVLPTSSLIKLDSPLMSFTDLQH 355 >ref|XP_019457999.1| PREDICTED: lys-63-specific deubiquitinase BRCC36-like [Lupinus angustifolius] ref|XP_019458000.1| PREDICTED: lys-63-specific deubiquitinase BRCC36-like [Lupinus angustifolius] gb|OIW03849.1| hypothetical protein TanjilG_30125 [Lupinus angustifolius] Length = 434 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQH 1 S A YV+KEIPLYVLP++SL+NL+SPL SYTDLQH Sbjct: 272 SVAEYVRKEIPLYVLPAASLINLDSPLSSYTDLQH 306 >ref|XP_021298574.1| lys-63-specific deubiquitinase BRCC36-like [Herrania umbratica] Length = 436 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQ 4 SGA YV+KEIPL+VLP+SSLVNL+SPL+S+TDLQ Sbjct: 272 SGAEYVRKEIPLHVLPTSSLVNLDSPLMSFTDLQ 305 >ref|XP_007023913.2| PREDICTED: lys-63-specific deubiquitinase BRCC36 [Theobroma cacao] Length = 436 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQ 4 SGA YV+KEIPL+VLP+SSLVNL+SPL+S+TDLQ Sbjct: 272 SGAEYVRKEIPLHVLPTSSLVNLDSPLMSFTDLQ 305 >gb|EOY26535.1| Mov34/MPN/PAD-1 family protein isoform 2 [Theobroma cacao] Length = 436 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQ 4 SGA YV+KEIPL+VLP+SSLVNL+SPL+S+TDLQ Sbjct: 272 SGAEYVRKEIPLHVLPTSSLVNLDSPLMSFTDLQ 305 >ref|XP_003543672.1| PREDICTED: lys-63-specific deubiquitinase BRCC36-like [Glycine max] gb|KHN44160.1| Lys-63-specific deubiquitinase BRCC36 [Glycine soja] gb|KRH23553.1| hypothetical protein GLYMA_13G363400 [Glycine max] Length = 436 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQH 1 SGA +V+KEIPLYVLP+ SL+N++SPL SYTDLQH Sbjct: 270 SGAEFVRKEIPLYVLPALSLINIDSPLSSYTDLQH 304 >ref|XP_004486693.1| PREDICTED: lys-63-specific deubiquitinase BRCC36-like [Cicer arietinum] Length = 438 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQH 1 SGA Y++KEIPLYVLPS SL+NL+SPL SY DLQH Sbjct: 270 SGAEYLRKEIPLYVLPSLSLINLDSPLSSYMDLQH 304 >ref|XP_003597836.2| Mov34/MPN/PAD-1 family protein [Medicago truncatula] gb|AES68087.2| Mov34/MPN/PAD-1 family protein [Medicago truncatula] Length = 443 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQH 1 SGA YV+KEIPL+VLPS S +NL+SPL SYTDLQH Sbjct: 270 SGAEYVRKEIPLHVLPSLSFINLDSPLSSYTDLQH 304 >gb|EOY26534.1| Mov34/MPN/PAD-1 family protein isoform 1 [Theobroma cacao] Length = 469 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQ 4 SGA YV+KEIPL+VLP+SSLVNL+SPL+S+TDLQ Sbjct: 305 SGAEYVRKEIPLHVLPTSSLVNLDSPLMSFTDLQ 338 >ref|XP_022714854.1| lys-63-specific deubiquitinase BRCC36-like [Durio zibethinus] Length = 436 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQH 1 SGA YV+KEIPL+VLP+SSLV+L+SPL S+TDLQH Sbjct: 272 SGAEYVRKEIPLHVLPTSSLVHLDSPLKSFTDLQH 306 >dbj|GAU11061.1| hypothetical protein TSUD_113550 [Trifolium subterraneum] Length = 449 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 105 SGA*YVKKEIPLYVLPSSSLVNLESPLLSYTDLQH 1 SGA YV+KEIPLYV PS SL+ L+SPL SYTDLQH Sbjct: 276 SGAEYVRKEIPLYVTPSMSLIKLDSPLSSYTDLQH 310