BLASTX nr result
ID: Astragalus23_contig00019046
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00019046 (525 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021899404.1| two-component response regulator ARR12 [Cari... 62 7e-08 gb|ACU18532.1| unknown, partial [Glycine max] 59 2e-07 ref|XP_016188779.1| two-component response regulator ARR12 isofo... 60 2e-07 ref|XP_015954155.1| two-component response regulator ARR12 isofo... 60 2e-07 ref|XP_016188778.1| two-component response regulator ARR12 isofo... 60 2e-07 ref|XP_015954153.1| two-component response regulator ARR12 isofo... 60 2e-07 ref|XP_020209450.1| two-component response regulator ARR12-like,... 56 2e-07 gb|KOM40223.1| hypothetical protein LR48_Vigan04g042100 [Vigna a... 60 3e-07 ref|XP_017422635.1| PREDICTED: two-component response regulator ... 60 3e-07 ref|XP_014496227.1| two-component response regulator ARR12 [Vign... 60 3e-07 ref|XP_006587150.1| PREDICTED: two-component response regulator ... 59 5e-07 ref|XP_023537616.1| two-component response regulator ORR24-like ... 59 5e-07 ref|XP_022965632.1| two-component response regulator ORR24-like ... 59 5e-07 ref|XP_022938161.1| two-component response regulator ORR24-like ... 59 5e-07 ref|XP_022134679.1| two-component response regulator ARR12 isofo... 59 5e-07 ref|XP_011655885.1| PREDICTED: two-component response regulator ... 59 5e-07 ref|XP_022134677.1| two-component response regulator ARR12 isofo... 59 5e-07 ref|XP_004146697.1| PREDICTED: two-component response regulator ... 59 5e-07 ref|XP_003533888.2| PREDICTED: two-component response regulator ... 59 5e-07 ref|XP_015892878.1| PREDICTED: two-component response regulator ... 59 5e-07 >ref|XP_021899404.1| two-component response regulator ARR12 [Carica papaya] Length = 641 Score = 61.6 bits (148), Expect = 7e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 214 NQSIEAPIMLRENRNKFDLVISDVNMPDMDGFN 312 NQ+IEA MLRENRNK+DLVISDVNMPDMDGFN Sbjct: 54 NQAIEALKMLRENRNKYDLVISDVNMPDMDGFN 86 >gb|ACU18532.1| unknown, partial [Glycine max] Length = 220 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 214 NQSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 NQ++EA MLRENRNKFDLVISDVNMPD+DGF Sbjct: 49 NQAVEALTMLRENRNKFDLVISDVNMPDIDGF 80 >ref|XP_016188779.1| two-component response regulator ARR12 isoform X2 [Arachis ipaensis] Length = 683 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 214 NQSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 NQ+IEA MLRENRNKFDLVISDVNMPDMDGF Sbjct: 44 NQAIEALRMLRENRNKFDLVISDVNMPDMDGF 75 >ref|XP_015954155.1| two-component response regulator ARR12 isoform X2 [Arachis duranensis] Length = 683 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 214 NQSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 NQ+IEA MLRENRNKFDLVISDVNMPDMDGF Sbjct: 44 NQAIEALRMLRENRNKFDLVISDVNMPDMDGF 75 >ref|XP_016188778.1| two-component response regulator ARR12 isoform X1 [Arachis ipaensis] Length = 687 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 214 NQSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 NQ+IEA MLRENRNKFDLVISDVNMPDMDGF Sbjct: 44 NQAIEALRMLRENRNKFDLVISDVNMPDMDGF 75 >ref|XP_015954153.1| two-component response regulator ARR12 isoform X1 [Arachis duranensis] Length = 687 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 214 NQSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 NQ+IEA MLRENRNKFDLVISDVNMPDMDGF Sbjct: 44 NQAIEALRMLRENRNKFDLVISDVNMPDMDGF 75 >ref|XP_020209450.1| two-component response regulator ARR12-like, partial [Cajanus cajan] Length = 87 Score = 56.2 bits (134), Expect = 2e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 217 QSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 QSI+A MLR+NRNKFDLVISDVNMPDMDGF Sbjct: 42 QSIKALEMLRKNRNKFDLVISDVNMPDMDGF 72 >gb|KOM40223.1| hypothetical protein LR48_Vigan04g042100 [Vigna angularis] Length = 654 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 214 NQSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 NQ++EA MLRENRNKFDLVISDVNMPDMDGF Sbjct: 54 NQAVEALKMLRENRNKFDLVISDVNMPDMDGF 85 >ref|XP_017422635.1| PREDICTED: two-component response regulator ARR12-like [Vigna angularis] dbj|BAT79713.1| hypothetical protein VIGAN_02263700 [Vigna angularis var. angularis] Length = 677 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 214 NQSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 NQ++EA MLRENRNKFDLVISDVNMPDMDGF Sbjct: 54 NQAVEALKMLRENRNKFDLVISDVNMPDMDGF 85 >ref|XP_014496227.1| two-component response regulator ARR12 [Vigna radiata var. radiata] Length = 677 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 214 NQSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 NQ++EA MLRENRNKFDLVISDVNMPDMDGF Sbjct: 54 NQAVEALKMLRENRNKFDLVISDVNMPDMDGF 85 >ref|XP_006587150.1| PREDICTED: two-component response regulator ARR12 isoform X2 [Glycine max] gb|KRH37917.1| hypothetical protein GLYMA_09G098600 [Glycine max] Length = 654 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 214 NQSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 NQ++EA MLRENRNKFDLVISDVNMPD+DGF Sbjct: 49 NQAVEALTMLRENRNKFDLVISDVNMPDIDGF 80 >ref|XP_023537616.1| two-component response regulator ORR24-like [Cucurbita pepo subsp. pepo] ref|XP_023537617.1| two-component response regulator ORR24-like [Cucurbita pepo subsp. pepo] Length = 655 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 214 NQSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 NQ+I+A MLRENRNKFDLVISDVNMPDMDGF Sbjct: 54 NQAIQALKMLRENRNKFDLVISDVNMPDMDGF 85 >ref|XP_022965632.1| two-component response regulator ORR24-like [Cucurbita maxima] ref|XP_022965633.1| two-component response regulator ORR24-like [Cucurbita maxima] ref|XP_022965634.1| two-component response regulator ORR24-like [Cucurbita maxima] Length = 655 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 214 NQSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 NQ+I+A MLRENRNKFDLVISDVNMPDMDGF Sbjct: 54 NQAIQALKMLRENRNKFDLVISDVNMPDMDGF 85 >ref|XP_022938161.1| two-component response regulator ORR24-like [Cucurbita moschata] ref|XP_022938162.1| two-component response regulator ORR24-like [Cucurbita moschata] Length = 655 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 214 NQSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 NQ+I+A MLRENRNKFDLVISDVNMPDMDGF Sbjct: 54 NQAIQALKMLRENRNKFDLVISDVNMPDMDGF 85 >ref|XP_022134679.1| two-component response regulator ARR12 isoform X2 [Momordica charantia] Length = 667 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 217 QSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 QSIEA MLRENRNKFDLVISDVNMPDMDGF Sbjct: 55 QSIEALRMLRENRNKFDLVISDVNMPDMDGF 85 >ref|XP_011655885.1| PREDICTED: two-component response regulator ARR12 isoform X2 [Cucumis sativus] Length = 678 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 217 QSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 QSIEA MLRENRNKFDLVISDVNMPDMDGF Sbjct: 55 QSIEALRMLRENRNKFDLVISDVNMPDMDGF 85 >ref|XP_022134677.1| two-component response regulator ARR12 isoform X1 [Momordica charantia] Length = 691 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 217 QSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 QSIEA MLRENRNKFDLVISDVNMPDMDGF Sbjct: 55 QSIEALRMLRENRNKFDLVISDVNMPDMDGF 85 >ref|XP_004146697.1| PREDICTED: two-component response regulator ARR12 isoform X1 [Cucumis sativus] gb|KGN65232.1| hypothetical protein Csa_1G267770 [Cucumis sativus] Length = 697 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 217 QSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 QSIEA MLRENRNKFDLVISDVNMPDMDGF Sbjct: 55 QSIEALRMLRENRNKFDLVISDVNMPDMDGF 85 >ref|XP_003533888.2| PREDICTED: two-component response regulator ARR12 isoform X1 [Glycine max] gb|KHN03659.1| Two-component response regulator ARR12 [Glycine soja] gb|KRH37916.1| hypothetical protein GLYMA_09G098600 [Glycine max] Length = 698 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 214 NQSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 NQ++EA MLRENRNKFDLVISDVNMPD+DGF Sbjct: 49 NQAVEALTMLRENRNKFDLVISDVNMPDIDGF 80 >ref|XP_015892878.1| PREDICTED: two-component response regulator ARR18-like [Ziziphus jujuba] Length = 704 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 214 NQSIEAPIMLRENRNKFDLVISDVNMPDMDGF 309 NQ+IEA MLRENRNK+DLVISDVNMPDMDGF Sbjct: 54 NQAIEALKMLRENRNKYDLVISDVNMPDMDGF 85