BLASTX nr result
ID: Astragalus23_contig00018977
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00018977 (267 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU40711.1| hypothetical protein TSUD_263610 [Trifolium subt... 58 1e-07 ref|XP_018858048.1| PREDICTED: receptor-like protein 12 [Juglans... 56 5e-07 ref|XP_018810514.1| PREDICTED: leucine-rich repeat receptor-like... 54 3e-06 ref|XP_018810513.1| PREDICTED: receptor-like protein 12 isoform ... 54 3e-06 ref|XP_018810512.1| PREDICTED: receptor-like protein 12 isoform ... 54 3e-06 ref|XP_013455168.1| verticillium wilt resistance-like protein [M... 54 3e-06 gb|KYP41800.1| LRR receptor-like serine/threonine-protein kinase... 53 5e-06 ref|XP_020239955.1| receptor-like protein 12 [Cajanus cajan] 53 5e-06 ref|XP_013455169.1| verticillium wilt disease resistance protein... 53 7e-06 >dbj|GAU40711.1| hypothetical protein TSUD_263610 [Trifolium subterraneum] Length = 1278 Score = 57.8 bits (138), Expect = 1e-07 Identities = 27/46 (58%), Positives = 33/46 (71%), Gaps = 4/46 (8%) Frame = +3 Query: 141 SNKCNNEVVQESPPPDSHT----TKSSIDWNFLSVELGFIVGFGMF 266 +N C N Q+SPPP S T +SSIDW+FLS+ELGFI GFG+F Sbjct: 1185 TNNCGNYETQQSPPPTSETPHSHNESSIDWSFLSMELGFIFGFGVF 1230 >ref|XP_018858048.1| PREDICTED: receptor-like protein 12 [Juglans regia] Length = 438 Score = 55.8 bits (133), Expect = 5e-07 Identities = 23/40 (57%), Positives = 32/40 (80%) Frame = +3 Query: 147 KCNNEVVQESPPPDSHTTKSSIDWNFLSVELGFIVGFGMF 266 KC +E + SPPP + + ++SIDW+FLSVELGF+ GFG+F Sbjct: 343 KCIHEELGPSPPPSNESHRNSIDWDFLSVELGFVFGFGIF 382 >ref|XP_018810514.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 isoform X3 [Juglans regia] Length = 946 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = +3 Query: 147 KCNNEVVQESPPPDSHTTKSSIDWNFLSVELGFIVGFGMF 266 KC +E + SPPP + +SIDW+FLSVELGF+ GFG+F Sbjct: 851 KCIHEELGPSPPPSKESHWNSIDWDFLSVELGFVFGFGIF 890 >ref|XP_018810513.1| PREDICTED: receptor-like protein 12 isoform X2 [Juglans regia] Length = 1068 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = +3 Query: 147 KCNNEVVQESPPPDSHTTKSSIDWNFLSVELGFIVGFGMF 266 KC +E + SPPP + +SIDW+FLSVELGF+ GFG+F Sbjct: 973 KCIHEELGPSPPPSKESHWNSIDWDFLSVELGFVFGFGIF 1012 >ref|XP_018810512.1| PREDICTED: receptor-like protein 12 isoform X1 [Juglans regia] Length = 1092 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = +3 Query: 147 KCNNEVVQESPPPDSHTTKSSIDWNFLSVELGFIVGFGMF 266 KC +E + SPPP + +SIDW+FLSVELGF+ GFG+F Sbjct: 997 KCIHEELGPSPPPSKESHWNSIDWDFLSVELGFVFGFGIF 1036 >ref|XP_013455168.1| verticillium wilt resistance-like protein [Medicago truncatula] gb|KEH28908.1| verticillium wilt resistance-like protein [Medicago truncatula] Length = 1110 Score = 53.5 bits (127), Expect = 3e-06 Identities = 26/46 (56%), Positives = 32/46 (69%), Gaps = 4/46 (8%) Frame = +3 Query: 141 SNKCNNEVVQESPPPDSHTTK----SSIDWNFLSVELGFIVGFGMF 266 S C+++ V PPP+S + SSIDWNFLSVELGFI GFG+F Sbjct: 1017 STNCDDDRVHGLPPPESELSHFHNDSSIDWNFLSVELGFIFGFGIF 1062 >gb|KYP41800.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Cajanus cajan] Length = 869 Score = 53.1 bits (126), Expect = 5e-06 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = +3 Query: 141 SNKCNNEVVQESPPPDSHTTKSSIDWNFLSVELGFIVGFGMF 266 ++ CNN+ V P SHT +SSIDWN LS ELGFI GFG+F Sbjct: 781 THNCNNDKVPTHETPHSHT-ESSIDWNLLSAELGFIFGFGIF 821 >ref|XP_020239955.1| receptor-like protein 12 [Cajanus cajan] Length = 1107 Score = 53.1 bits (126), Expect = 5e-06 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = +3 Query: 141 SNKCNNEVVQESPPPDSHTTKSSIDWNFLSVELGFIVGFGMF 266 ++ CNN+ V P SHT +SSIDWN LS ELGFI GFG+F Sbjct: 1019 THNCNNDKVPTHETPHSHT-ESSIDWNLLSAELGFIFGFGIF 1059 >ref|XP_013455169.1| verticillium wilt disease resistance protein [Medicago truncatula] gb|KEH28909.1| verticillium wilt disease resistance protein [Medicago truncatula] Length = 1439 Score = 52.8 bits (125), Expect = 7e-06 Identities = 25/46 (54%), Positives = 34/46 (73%), Gaps = 4/46 (8%) Frame = +3 Query: 141 SNKCNNEVVQESPPPDSHT----TKSSIDWNFLSVELGFIVGFGMF 266 ++ C+++ +Q PP S + T+SSIDWNFLSVELGFI GFG+F Sbjct: 1346 TSNCSDDGIQGLPPQASESSHSHTESSIDWNFLSVELGFIFGFGVF 1391