BLASTX nr result
ID: Astragalus23_contig00018935
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00018935 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX91628.1| exosome complex exonuclease rrp44-like protein, p... 75 7e-15 ref|XP_014631919.1| PREDICTED: exosome complex exonuclease RRP44... 78 3e-14 ref|XP_020203103.1| exosome complex exonuclease RRP44 homolog A ... 78 3e-14 gb|KYP39428.1| Exosome complex exonuclease RRP44 [Cajanus cajan] 78 3e-14 ref|XP_020203102.1| exosome complex exonuclease RRP44 homolog A ... 78 3e-14 gb|KHN25814.1| Exosome complex exonuclease RRP44 [Glycine soja] 78 3e-14 ref|XP_003526807.1| PREDICTED: exosome complex exonuclease RRP44... 78 3e-14 ref|XP_016180313.1| exosome complex exonuclease RRP44 homolog A ... 77 6e-14 ref|XP_015950933.1| exosome complex exonuclease RRP44 homolog A ... 77 6e-14 gb|OIW02082.1| hypothetical protein TanjilG_14781 [Lupinus angus... 77 1e-13 ref|XP_019461134.1| PREDICTED: exosome complex exonuclease RRP44... 77 1e-13 ref|XP_014630387.1| PREDICTED: exosome complex exonuclease RRP44... 77 1e-13 ref|XP_006578840.1| PREDICTED: exosome complex exonuclease RRP44... 77 1e-13 gb|KRH64199.1| hypothetical protein GLYMA_04G221900 [Glycine max] 77 1e-13 ref|XP_017421894.1| PREDICTED: exosome complex exonuclease RRP44... 76 2e-13 ref|XP_007137628.1| hypothetical protein PHAVU_009G142600g [Phas... 76 2e-13 ref|XP_014501295.1| exosome complex exonuclease RRP44 homolog A ... 76 2e-13 ref|XP_014501294.1| exosome complex exonuclease RRP44 homolog A ... 76 2e-13 dbj|GAU42819.1| hypothetical protein TSUD_185770 [Trifolium subt... 76 2e-13 gb|PNY13255.1| exosome complex exonuclease rrp44-like protein, p... 75 4e-13 >gb|PNX91628.1| exosome complex exonuclease rrp44-like protein, partial [Trifolium pratense] Length = 116 Score = 75.1 bits (183), Expect = 7e-15 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KTK GKVMKQVREHYLRDDIYCGAP C Sbjct: 1 MLHNKSFVKKTKGGKVMKQVREHYLRDDIYCGAPSC 36 >ref|XP_014631919.1| PREDICTED: exosome complex exonuclease RRP44-like isoform X5 [Glycine max] Length = 782 Score = 78.2 bits (191), Expect = 3e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KTK GKVMKQVREHYLRDDIYCGAPFC Sbjct: 1 MLHNKSFVKKTKGGKVMKQVREHYLRDDIYCGAPFC 36 >ref|XP_020203103.1| exosome complex exonuclease RRP44 homolog A isoform X2 [Cajanus cajan] Length = 933 Score = 78.2 bits (191), Expect = 3e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KTK GKVMKQVREHYLRDDIYCGAPFC Sbjct: 1 MLHNKSFVKKTKGGKVMKQVREHYLRDDIYCGAPFC 36 >gb|KYP39428.1| Exosome complex exonuclease RRP44 [Cajanus cajan] Length = 933 Score = 78.2 bits (191), Expect = 3e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KTK GKVMKQVREHYLRDDIYCGAPFC Sbjct: 1 MLHNKSFVKKTKGGKVMKQVREHYLRDDIYCGAPFC 36 >ref|XP_020203102.1| exosome complex exonuclease RRP44 homolog A isoform X1 [Cajanus cajan] Length = 934 Score = 78.2 bits (191), Expect = 3e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KTK GKVMKQVREHYLRDDIYCGAPFC Sbjct: 1 MLHNKSFVKKTKGGKVMKQVREHYLRDDIYCGAPFC 36 >gb|KHN25814.1| Exosome complex exonuclease RRP44 [Glycine soja] Length = 934 Score = 78.2 bits (191), Expect = 3e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KTK GKVMKQVREHYLRDDIYCGAPFC Sbjct: 1 MLHNKSFVKKTKGGKVMKQVREHYLRDDIYCGAPFC 36 >ref|XP_003526807.1| PREDICTED: exosome complex exonuclease RRP44-like isoform X1 [Glycine max] ref|XP_006581716.1| PREDICTED: exosome complex exonuclease RRP44-like isoform X2 [Glycine max] ref|XP_006581717.1| PREDICTED: exosome complex exonuclease RRP44-like isoform X1 [Glycine max] ref|XP_006581718.1| PREDICTED: exosome complex exonuclease RRP44-like isoform X1 [Glycine max] gb|KRH53736.1| hypothetical protein GLYMA_06G143500 [Glycine max] gb|KRH53737.1| hypothetical protein GLYMA_06G143500 [Glycine max] gb|KRH53738.1| hypothetical protein GLYMA_06G143500 [Glycine max] gb|KRH53739.1| hypothetical protein GLYMA_06G143500 [Glycine max] Length = 934 Score = 78.2 bits (191), Expect = 3e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KTK GKVMKQVREHYLRDDIYCGAPFC Sbjct: 1 MLHNKSFVKKTKGGKVMKQVREHYLRDDIYCGAPFC 36 >ref|XP_016180313.1| exosome complex exonuclease RRP44 homolog A [Arachis ipaensis] Length = 935 Score = 77.4 bits (189), Expect = 6e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KTK GKVMKQVREHYLRDDIYCGAPFC Sbjct: 1 MLHNKSFVKKTKAGKVMKQVREHYLRDDIYCGAPFC 36 >ref|XP_015950933.1| exosome complex exonuclease RRP44 homolog A [Arachis duranensis] Length = 935 Score = 77.4 bits (189), Expect = 6e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KTK GKVMKQVREHYLRDDIYCGAPFC Sbjct: 1 MLHNKSFVKKTKAGKVMKQVREHYLRDDIYCGAPFC 36 >gb|OIW02082.1| hypothetical protein TanjilG_14781 [Lupinus angustifolius] Length = 897 Score = 76.6 bits (187), Expect = 1e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFCK 1 MLHNKSFV+KTK G+VMKQVREHYLRDDI+CGAPFCK Sbjct: 1 MLHNKSFVKKTKAGRVMKQVREHYLRDDIFCGAPFCK 37 >ref|XP_019461134.1| PREDICTED: exosome complex exonuclease RRP44 homolog A [Lupinus angustifolius] ref|XP_019461136.1| PREDICTED: exosome complex exonuclease RRP44 homolog A [Lupinus angustifolius] Length = 933 Score = 76.6 bits (187), Expect = 1e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFCK 1 MLHNKSFV+KTK G+VMKQVREHYLRDDI+CGAPFCK Sbjct: 1 MLHNKSFVKKTKAGRVMKQVREHYLRDDIFCGAPFCK 37 >ref|XP_014630387.1| PREDICTED: exosome complex exonuclease RRP44-like isoform X3 [Glycine max] Length = 933 Score = 76.6 bits (187), Expect = 1e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KTK GKV+KQVREHYLRDDIYCGAPFC Sbjct: 1 MLHNKSFVKKTKGGKVIKQVREHYLRDDIYCGAPFC 36 >ref|XP_006578840.1| PREDICTED: exosome complex exonuclease RRP44-like isoform X2 [Glycine max] ref|XP_006578841.1| PREDICTED: exosome complex exonuclease RRP44-like isoform X1 [Glycine max] Length = 934 Score = 76.6 bits (187), Expect = 1e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KTK GKV+KQVREHYLRDDIYCGAPFC Sbjct: 1 MLHNKSFVKKTKGGKVIKQVREHYLRDDIYCGAPFC 36 >gb|KRH64199.1| hypothetical protein GLYMA_04G221900 [Glycine max] Length = 935 Score = 76.6 bits (187), Expect = 1e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KTK GKV+KQVREHYLRDDIYCGAPFC Sbjct: 1 MLHNKSFVKKTKGGKVIKQVREHYLRDDIYCGAPFC 36 >ref|XP_017421894.1| PREDICTED: exosome complex exonuclease RRP44 homolog A [Vigna angularis] dbj|BAT79018.1| hypothetical protein VIGAN_02181000 [Vigna angularis var. angularis] Length = 934 Score = 76.3 bits (186), Expect = 2e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KT+ GKVMKQVREHYLRDDIYCGAPFC Sbjct: 1 MLHNKSFVKKTRAGKVMKQVREHYLRDDIYCGAPFC 36 >ref|XP_007137628.1| hypothetical protein PHAVU_009G142600g [Phaseolus vulgaris] gb|ESW09622.1| hypothetical protein PHAVU_009G142600g [Phaseolus vulgaris] Length = 935 Score = 76.3 bits (186), Expect = 2e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KT+ GKVMKQVREHYLRDDIYCGAPFC Sbjct: 1 MLHNKSFVKKTRAGKVMKQVREHYLRDDIYCGAPFC 36 >ref|XP_014501295.1| exosome complex exonuclease RRP44 homolog A isoform X2 [Vigna radiata var. radiata] Length = 936 Score = 76.3 bits (186), Expect = 2e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KT+ GKVMKQVREHYLRDDIYCGAPFC Sbjct: 1 MLHNKSFVKKTRAGKVMKQVREHYLRDDIYCGAPFC 36 >ref|XP_014501294.1| exosome complex exonuclease RRP44 homolog A isoform X1 [Vigna radiata var. radiata] ref|XP_022636303.1| exosome complex exonuclease RRP44 homolog A isoform X1 [Vigna radiata var. radiata] Length = 937 Score = 76.3 bits (186), Expect = 2e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KT+ GKVMKQVREHYLRDDIYCGAPFC Sbjct: 1 MLHNKSFVKKTRAGKVMKQVREHYLRDDIYCGAPFC 36 >dbj|GAU42819.1| hypothetical protein TSUD_185770 [Trifolium subterraneum] Length = 622 Score = 75.9 bits (185), Expect = 2e-13 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNK++V+KTK GKVMKQVREHYLRDDIYCGAPFC Sbjct: 1 MLHNKAYVKKTKGGKVMKQVREHYLRDDIYCGAPFC 36 >gb|PNY13255.1| exosome complex exonuclease rrp44-like protein, partial [Trifolium pratense] Length = 545 Score = 75.1 bits (183), Expect = 4e-13 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 111 MLHNKSFVRKTKNGKVMKQVREHYLRDDIYCGAPFC 4 MLHNKSFV+KTK GKVMKQVREHYLRDDIYCGAP C Sbjct: 1 MLHNKSFVKKTKGGKVMKQVREHYLRDDIYCGAPSC 36