BLASTX nr result
ID: Astragalus23_contig00018745
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00018745 (552 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013457610.1| DWNN domain, A CCHC-type zinc finger protein... 75 1e-16 >ref|XP_013457610.1| DWNN domain, A CCHC-type zinc finger protein [Medicago truncatula] gb|KEH31641.1| DWNN domain, A CCHC-type zinc finger protein [Medicago truncatula] Length = 748 Score = 75.5 bits (184), Expect(2) = 1e-16 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 2/72 (2%) Frame = -2 Query: 551 SSIKSKTVCAFRCLNFPLYPRGLLCSIYFLWSVDQKFGQKPEACERTLIALDNSTHSF-F 375 SSIKSKTVC F CLNF GLLC+ FLW KF Q P AC RTLIALDN+++ F Sbjct: 641 SSIKSKTVCTFYCLNFHPSLFGLLCACDFLWFFYLKFAQNPPACRRTLIALDNTSNYFCS 700 Query: 374 FNYCSL-GNCFI 342 FNY ++ GN F+ Sbjct: 701 FNYIAVFGNYFM 712 Score = 38.1 bits (87), Expect(2) = 1e-16 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -1 Query: 348 FYWRHLSIKRFVYQVMLSG*S*NG*GSVDPLALPLFYGHQRQMV 217 F W H IKRFVYQ +L P LPLFYG Q+QMV Sbjct: 711 FMWLHSLIKRFVYQAIL------WLREGCPFVLPLFYGPQQQMV 748