BLASTX nr result
ID: Astragalus23_contig00018617
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00018617 (403 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004507369.1| PREDICTED: B3 domain-containing transcriptio... 80 9e-15 ref|XP_004507368.1| PREDICTED: B3 domain-containing transcriptio... 80 9e-15 gb|ACJ84317.1| unknown, partial [Medicago truncatula] 78 3e-14 ref|XP_003606842.1| B3 domain transcription factor VRN1-like pro... 78 4e-14 ref|XP_020217076.1| B3 domain-containing transcription factor VR... 77 8e-14 dbj|GAU48959.1| hypothetical protein TSUD_89040, partial [Trifol... 75 4e-13 ref|XP_017432947.1| PREDICTED: B3 domain-containing transcriptio... 75 4e-13 ref|XP_014494289.1| B3 domain-containing transcription factor VR... 75 5e-13 ref|XP_022634057.1| B3 domain-containing transcription factor VR... 75 5e-13 ref|XP_003537916.1| PREDICTED: B3 domain-containing transcriptio... 72 4e-12 ref|XP_003541121.1| PREDICTED: B3 domain-containing transcriptio... 70 2e-11 gb|KHN25328.1| B3 domain-containing transcription factor VRN1 [G... 70 2e-11 ref|XP_006592124.1| PREDICTED: B3 domain-containing transcriptio... 70 2e-11 ref|XP_007131905.1| hypothetical protein PHAVU_011G050600g [Phas... 70 3e-11 ref|XP_015952089.1| B3 domain-containing transcription factor VR... 67 3e-10 ref|XP_016187087.1| B3 domain-containing transcription factor VR... 67 3e-10 ref|XP_015952088.1| B3 domain-containing transcription factor VR... 67 3e-10 ref|XP_004498177.1| PREDICTED: B3 domain-containing transcriptio... 67 4e-10 ref|XP_019454157.1| PREDICTED: B3 domain-containing transcriptio... 66 5e-10 ref|XP_016187086.1| B3 domain-containing transcription factor VR... 65 1e-09 >ref|XP_004507369.1| PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X2 [Cicer arietinum] Length = 431 Score = 79.7 bits (195), Expect = 9e-15 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQAKQLRLPDNFMSKYGGELSPIVTLSV 401 MP PSFHKLVLPSTLQAKQLRLPDNFM KYGG++SPIVTL+V Sbjct: 1 MPCPSFHKLVLPSTLQAKQLRLPDNFMRKYGGQISPIVTLTV 42 >ref|XP_004507368.1| PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X1 [Cicer arietinum] Length = 436 Score = 79.7 bits (195), Expect = 9e-15 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQAKQLRLPDNFMSKYGGELSPIVTLSV 401 MP PSFHKLVLPSTLQAKQLRLPDNFM KYGG++SPIVTL+V Sbjct: 1 MPCPSFHKLVLPSTLQAKQLRLPDNFMRKYGGQISPIVTLTV 42 >gb|ACJ84317.1| unknown, partial [Medicago truncatula] Length = 324 Score = 77.8 bits (190), Expect = 3e-14 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQAKQLRLPDNFMSKYGGELSPIVTLSV 401 MPSPSFHKLVLPSTLQAKQLRLPD+FM KYGG++SP VTL+V Sbjct: 1 MPSPSFHKLVLPSTLQAKQLRLPDDFMRKYGGDISPTVTLTV 42 >ref|XP_003606842.1| B3 domain transcription factor VRN1-like protein [Medicago truncatula] gb|AES89039.1| B3 domain transcription factor VRN1-like protein [Medicago truncatula] Length = 429 Score = 77.8 bits (190), Expect = 4e-14 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQAKQLRLPDNFMSKYGGELSPIVTLSV 401 MPSPSFHKLVLPSTLQAKQLRLPD+FM KYGG++SP VTL+V Sbjct: 1 MPSPSFHKLVLPSTLQAKQLRLPDDFMRKYGGDISPTVTLTV 42 >ref|XP_020217076.1| B3 domain-containing transcription factor VRN1-like isoform X1 [Cajanus cajan] gb|KYP66011.1| B3 domain-containing transcription factor VRN1 [Cajanus cajan] Length = 423 Score = 77.0 bits (188), Expect = 8e-14 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQAKQLRLPDNFMSKYGGELSPIVTLSV 401 MP PSFHKL+LPSTLQ QLRLPDNFM KYGGE+SPIVTLSV Sbjct: 1 MPHPSFHKLLLPSTLQPNQLRLPDNFMRKYGGEISPIVTLSV 42 >dbj|GAU48959.1| hypothetical protein TSUD_89040, partial [Trifolium subterraneum] Length = 428 Score = 75.1 bits (183), Expect = 4e-13 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = +3 Query: 273 KMPSPSFHKLVLPSTLQAKQLRLPDNFMSKYGGELSPIVTLSV 401 KMPSPSFHKL+LPSTL+AKQLRLPD+F+ KYGG +S IVTL+V Sbjct: 21 KMPSPSFHKLILPSTLEAKQLRLPDDFVKKYGGNMSSIVTLTV 63 >ref|XP_017432947.1| PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X2 [Vigna angularis] dbj|BAT90870.1| hypothetical protein VIGAN_06216100 [Vigna angularis var. angularis] Length = 428 Score = 75.1 bits (183), Expect = 4e-13 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQAKQLRLPDNFMSKYGGELSPIVTLSV 401 M PSFHKL+LPSTLQ KQLRLPD+FM KYGGELSPIVTLSV Sbjct: 1 MTHPSFHKLLLPSTLQTKQLRLPDDFMRKYGGELSPIVTLSV 42 >ref|XP_014494289.1| B3 domain-containing transcription factor VRN1 isoform X4 [Vigna radiata var. radiata] Length = 429 Score = 74.7 bits (182), Expect = 5e-13 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQAKQLRLPDNFMSKYGGELSPIVTLSV 401 M PSFHKL+LPSTLQ KQLRLPD+FM KYGGELSPIVTLSV Sbjct: 1 MTHPSFHKLLLPSTLQPKQLRLPDDFMRKYGGELSPIVTLSV 42 >ref|XP_022634057.1| B3 domain-containing transcription factor VRN1 isoform X2 [Vigna radiata var. radiata] Length = 431 Score = 74.7 bits (182), Expect = 5e-13 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQAKQLRLPDNFMSKYGGELSPIVTLSV 401 M PSFHKL+LPSTLQ KQLRLPD+FM KYGGELSPIVTLSV Sbjct: 1 MTHPSFHKLLLPSTLQPKQLRLPDDFMRKYGGELSPIVTLSV 42 >ref|XP_003537916.1| PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X1 [Glycine max] gb|KHN06172.1| B3 domain-containing transcription factor VRN1 [Glycine soja] gb|KRH29559.1| hypothetical protein GLYMA_11G124100 [Glycine max] gb|KRH29560.1| hypothetical protein GLYMA_11G124100 [Glycine max] Length = 431 Score = 72.4 bits (176), Expect = 4e-12 Identities = 36/43 (83%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQA-KQLRLPDNFMSKYGGELSPIVTLSV 401 MP PSFHKL+LPST+Q +QLRLPDNFM KYGGELSPIVTLSV Sbjct: 1 MPHPSFHKLLLPSTVQPNQQLRLPDNFMRKYGGELSPIVTLSV 43 >ref|XP_003541121.1| PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X2 [Glycine max] gb|KRH24553.1| hypothetical protein GLYMA_12G048600 [Glycine max] Length = 436 Score = 70.1 bits (170), Expect = 2e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQA-KQLRLPDNFMSKYGGELSPIVTLSV 401 MP PSFHKL+LPST+Q +QLRLPDNFM KYGGEL PIVTLSV Sbjct: 1 MPHPSFHKLLLPSTVQPNQQLRLPDNFMRKYGGELLPIVTLSV 43 >gb|KHN25328.1| B3 domain-containing transcription factor VRN1 [Glycine soja] Length = 439 Score = 70.1 bits (170), Expect = 2e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQA-KQLRLPDNFMSKYGGELSPIVTLSV 401 MP PSFHKL+LPST+Q +QLRLPDNFM KYGGEL PIVTLSV Sbjct: 1 MPHPSFHKLLLPSTVQPNQQLRLPDNFMRKYGGELLPIVTLSV 43 >ref|XP_006592124.1| PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X1 [Glycine max] gb|KRH24554.1| hypothetical protein GLYMA_12G048600 [Glycine max] Length = 441 Score = 70.1 bits (170), Expect = 2e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQA-KQLRLPDNFMSKYGGELSPIVTLSV 401 MP PSFHKL+LPST+Q +QLRLPDNFM KYGGEL PIVTLSV Sbjct: 1 MPHPSFHKLLLPSTVQPNQQLRLPDNFMRKYGGELLPIVTLSV 43 >ref|XP_007131905.1| hypothetical protein PHAVU_011G050600g [Phaseolus vulgaris] gb|ESW03899.1| hypothetical protein PHAVU_011G050600g [Phaseolus vulgaris] Length = 430 Score = 69.7 bits (169), Expect = 3e-11 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQAKQLRLPDNFMSKYGGELSPIVTLSV 401 M PSFHKL+LPSTLQ QLRLPD+FM KYG ELSPIVTLSV Sbjct: 1 MTHPSFHKLLLPSTLQPNQLRLPDDFMRKYGRELSPIVTLSV 42 >ref|XP_015952089.1| B3 domain-containing transcription factor VRN1 isoform X2 [Arachis duranensis] Length = 389 Score = 67.0 bits (162), Expect = 3e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQAKQLRLPDNFMSKYGGELSPIVTLSV 401 MP PSFHK++L +TLQ+KQLR+PDNF+ KYGGELS V LSV Sbjct: 1 MPRPSFHKVILTTTLQSKQLRVPDNFLRKYGGELSSFVNLSV 42 >ref|XP_016187087.1| B3 domain-containing transcription factor VRN1 [Arachis ipaensis] Length = 392 Score = 67.0 bits (162), Expect = 3e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQAKQLRLPDNFMSKYGGELSPIVTLSV 401 MP PSFHK++L +TLQ+KQLR+PDNF+ KYGGELS V LSV Sbjct: 1 MPRPSFHKVILTTTLQSKQLRVPDNFLRKYGGELSSFVNLSV 42 >ref|XP_015952088.1| B3 domain-containing transcription factor VRN1 isoform X1 [Arachis duranensis] Length = 392 Score = 67.0 bits (162), Expect = 3e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQAKQLRLPDNFMSKYGGELSPIVTLSV 401 MP PSFHK++L +TLQ+KQLR+PDNF+ KYGGELS V LSV Sbjct: 1 MPRPSFHKVILTTTLQSKQLRVPDNFLRKYGGELSSFVNLSV 42 >ref|XP_004498177.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Cicer arietinum] Length = 434 Score = 66.6 bits (161), Expect = 4e-10 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQAKQLRLPDNFMSKYGGELSPIVTLSV 401 MP PSFHKL+LP TLQ++QLR+PDNF+ KYG +LS I TL+V Sbjct: 1 MPRPSFHKLILPITLQSRQLRIPDNFLRKYGAQLSAIATLTV 42 >ref|XP_019454157.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Lupinus angustifolius] ref|XP_019454158.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Lupinus angustifolius] Length = 427 Score = 66.2 bits (160), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQAKQLRLPDNFMSKYGGELSPIVTLSV 401 MP PSF KLVLPSTLQA Q+R+PD+F+ KYGGELS TLSV Sbjct: 1 MPHPSFFKLVLPSTLQANQMRIPDDFLRKYGGELSATATLSV 42 >ref|XP_016187086.1| B3 domain-containing transcription factor VRN1 [Arachis ipaensis] Length = 422 Score = 65.5 bits (158), Expect = 1e-09 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +3 Query: 276 MPSPSFHKLVLPSTLQAKQLRLPDNFMSKYGGELSPIVTLSV 401 MP PSFHKLVLPST+Q++QLR+PD F+++YG +LS I T SV Sbjct: 1 MPRPSFHKLVLPSTIQSRQLRIPDTFLNRYGADLSSIATFSV 42