BLASTX nr result
ID: Astragalus23_contig00018615
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00018615 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004513856.1| PREDICTED: uncharacterized protein LOC101510... 63 1e-08 dbj|GAU24247.1| hypothetical protein TSUD_23840 [Trifolium subte... 63 2e-08 ref|XP_013442637.1| transmembrane protein, putative [Medicago tr... 58 7e-07 >ref|XP_004513856.1| PREDICTED: uncharacterized protein LOC101510562 [Cicer arietinum] Length = 771 Score = 63.2 bits (152), Expect = 1e-08 Identities = 32/54 (59%), Positives = 33/54 (61%) Frame = -1 Query: 162 MLVQERTXXXXXXXXXXXXXXXPYLRSTQLPTNRFTETKNLDFSVWVSDNLYKI 1 MLVQER+ YLR T LPTNR ET NLDFSVWVSDNLYKI Sbjct: 1 MLVQERSSAQKPSNQNPNPKPKIYLRDTHLPTNRIVETNNLDFSVWVSDNLYKI 54 >dbj|GAU24247.1| hypothetical protein TSUD_23840 [Trifolium subterraneum] Length = 789 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 93 YLRSTQLPTNRFTETKNLDFSVWVSDNLYKI 1 YLR T LPTNRFTETKNLDFSVWVS+NLYKI Sbjct: 26 YLRKTDLPTNRFTETKNLDFSVWVSENLYKI 56 >ref|XP_013442637.1| transmembrane protein, putative [Medicago truncatula] gb|KEH16662.1| transmembrane protein, putative [Medicago truncatula] Length = 571 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 93 YLRSTQLPTNRFTETKNLDFSVWVSDNLYKI 1 YL+ + LPTNRFT TKNLDFSVWVS+NLYKI Sbjct: 22 YLKKSDLPTNRFTHTKNLDFSVWVSENLYKI 52