BLASTX nr result
ID: Astragalus23_contig00018602
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00018602 (482 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013442549.1| Ulp1 protease family, carboxy-terminal domai... 75 8e-13 gb|PNX56788.1| Ulp1 protease family C-terminal catalytic domain ... 62 2e-09 >ref|XP_013442549.1| Ulp1 protease family, carboxy-terminal domain protein [Medicago truncatula] gb|KEH16574.1| Ulp1 protease family, carboxy-terminal domain protein [Medicago truncatula] Length = 842 Score = 75.5 bits (184), Expect = 8e-13 Identities = 40/98 (40%), Positives = 58/98 (59%), Gaps = 3/98 (3%) Frame = +3 Query: 180 RKRVKKPSKYLKSPYDGHVAKADVVENDKNLVTYIWCPDQPHAKTMYNCGDPR---FTLS 350 R+RV SKYL SPYD V ++ E KNL TY W + + +Y C D R + + Sbjct: 525 RRRVVNKSKYLDSPYDDAVHESTATELQKNLSTYAWSSELDQDELLY-CSDNRAHDYFVE 583 Query: 351 RQELWTLQENQWVSNLVVDCYAMLLNLGENRDEMRRLV 464 R +LW+LQ+++WVS V++ + LN + RD+M RLV Sbjct: 584 RIDLWSLQQDKWVSCFVINVWINCLNWNQQRDKMTRLV 621 >gb|PNX56788.1| Ulp1 protease family C-terminal catalytic domain containing protein, partial [Trifolium pratense] Length = 136 Score = 62.4 bits (150), Expect = 2e-09 Identities = 31/86 (36%), Positives = 51/86 (59%), Gaps = 3/86 (3%) Frame = +3 Query: 216 SPYDGHVAKADVVENDKNLVTYIWCPDQPHAKTMYNCGDPR---FTLSRQELWTLQENQW 386 SPYD V +++ + K++ TY W + +Y C D + F+L R +LWTLQ+++W Sbjct: 2 SPYDEAVYESNATKVHKDISTYAWSISHDETEILY-CSDNKAHAFSLQRSDLWTLQKDEW 60 Query: 387 VSNLVVDCYAMLLNLGENRDEMRRLV 464 VS V++ +A LN + D++ RLV Sbjct: 61 VSCFVINSWANCLNWSQRNDKVTRLV 86