BLASTX nr result
ID: Astragalus23_contig00018561
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00018561 (892 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU47218.1| hypothetical protein TSUD_403590 [Trifolium subt... 96 1e-20 ref|XP_004485985.1| PREDICTED: pentatricopeptide repeat-containi... 97 3e-19 gb|KHN06955.1| Pentatricopeptide repeat-containing protein, mito... 90 7e-18 ref|XP_003593879.1| PPR containing plant-like protein [Medicago ... 93 8e-18 ref|XP_003546072.1| PREDICTED: pentatricopeptide repeat-containi... 92 2e-17 dbj|GAU16660.1| hypothetical protein TSUD_326100 [Trifolium subt... 91 6e-17 ref|XP_006594515.1| PREDICTED: pentatricopeptide repeat-containi... 90 9e-17 ref|XP_007147943.1| hypothetical protein PHAVU_006G167600g [Phas... 90 1e-16 gb|KYP45163.1| hypothetical protein KK1_033296 [Cajanus cajan] 89 2e-16 ref|XP_020237006.1| pentatricopeptide repeat-containing protein ... 89 2e-16 ref|XP_015944245.2| LOW QUALITY PROTEIN: pentatricopeptide repea... 87 1e-15 ref|XP_016171421.1| pentatricopeptide repeat-containing protein ... 84 8e-15 ref|XP_015936999.1| pentatricopeptide repeat-containing protein ... 84 8e-15 ref|XP_019434617.1| PREDICTED: pentatricopeptide repeat-containi... 83 3e-14 ref|XP_020968859.1| pentatricopeptide repeat-containing protein ... 79 4e-14 ref|XP_017434945.1| PREDICTED: pentatricopeptide repeat-containi... 80 4e-13 ref|XP_014517645.2| pentatricopeptide repeat-containing protein ... 80 4e-13 ref|XP_002534359.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_021655305.1| pentatricopeptide repeat-containing protein ... 77 3e-12 ref|XP_021633620.1| pentatricopeptide repeat-containing protein ... 75 2e-11 >dbj|GAU47218.1| hypothetical protein TSUD_403590 [Trifolium subterraneum] Length = 166 Score = 96.3 bits (238), Expect = 1e-20 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLCREGRVD+AFELLDECKKRD M+EKMYK LFNDL+FVC+D Sbjct: 116 LTYKTVLEGLCREGRVDDAFELLDECKKRDFYMNEKMYKTLFNDLQFVCRD 166 >ref|XP_004485985.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Cicer arietinum] Length = 369 Score = 97.1 bits (240), Expect = 3e-19 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLCREGRVD+AFELLDECKKRD M+EKMYK LFNDLRFVC+D Sbjct: 319 LTYKTVLEGLCREGRVDDAFELLDECKKRDGFMNEKMYKTLFNDLRFVCRD 369 >gb|KHN06955.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 210 Score = 90.1 bits (222), Expect = 7e-18 Identities = 43/51 (84%), Positives = 44/51 (86%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLC EGRVDEAFELLDECKKRDVSM EK YK L NDL VC+D Sbjct: 160 LTYKTVLEGLCHEGRVDEAFELLDECKKRDVSMGEKTYKSLLNDLYVVCRD 210 >ref|XP_003593879.1| PPR containing plant-like protein [Medicago truncatula] gb|AES64130.1| PPR containing plant-like protein [Medicago truncatula] Length = 360 Score = 92.8 bits (229), Expect = 8e-18 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLC EGRVDEAFELLDE KKRDV M+E+MYK LFNDL+FVC+D Sbjct: 310 LTYKTVLEGLCHEGRVDEAFELLDEFKKRDVGMNERMYKTLFNDLQFVCRD 360 >ref|XP_003546072.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Glycine max] gb|KRH11141.1| hypothetical protein GLYMA_15G091700 [Glycine max] Length = 372 Score = 92.0 bits (227), Expect = 2e-17 Identities = 44/51 (86%), Positives = 45/51 (88%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSM EK YK L NDL VC+D Sbjct: 322 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMGEKTYKSLLNDLYVVCRD 372 >dbj|GAU16660.1| hypothetical protein TSUD_326100 [Trifolium subterraneum] Length = 368 Score = 90.5 bits (223), Expect = 6e-17 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLC E RVD+AFELLDECKKRD M+EKMYK LFNDL+FVC+D Sbjct: 318 LTYKTVLEGLCLERRVDDAFELLDECKKRDFYMNEKMYKTLFNDLQFVCRD 368 >ref|XP_006594515.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Glycine max] gb|KRH21107.1| hypothetical protein GLYMA_13G220800 [Glycine max] Length = 375 Score = 90.1 bits (222), Expect = 9e-17 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSM EK YK L NDL +C++ Sbjct: 325 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMGEKTYKSLLNDLYVICRE 375 >ref|XP_007147943.1| hypothetical protein PHAVU_006G167600g [Phaseolus vulgaris] gb|ESW19937.1| hypothetical protein PHAVU_006G167600g [Phaseolus vulgaris] Length = 373 Score = 89.7 bits (221), Expect = 1e-16 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLCREGRVD+AFELLDECKKRD SM EKMYK L DL F C++ Sbjct: 323 LTYKTVLEGLCREGRVDDAFELLDECKKRDASMGEKMYKTLLEDLHFSCRE 373 >gb|KYP45163.1| hypothetical protein KK1_033296 [Cajanus cajan] Length = 366 Score = 89.0 bits (219), Expect = 2e-16 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLCREGR DEAFELLDECKKRD SM EKMYK L N+L VC++ Sbjct: 316 LTYKTVLEGLCREGRADEAFELLDECKKRDASMGEKMYKALLNELYVVCRE 366 >ref|XP_020237006.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Cajanus cajan] Length = 382 Score = 89.0 bits (219), Expect = 2e-16 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLCREGR DEAFELLDECKKRD SM EKMYK L N+L VC++ Sbjct: 332 LTYKTVLEGLCREGRADEAFELLDECKKRDASMGEKMYKALLNELYVVCRE 382 >ref|XP_015944245.2| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Arachis duranensis] Length = 392 Score = 87.0 bits (214), Expect = 1e-15 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLCREGR DEAF+LLDEC+KRDV+M+EKMYK L +L ++C++ Sbjct: 340 LTYKTVLEGLCREGRADEAFDLLDECRKRDVNMNEKMYKALLRELHYICRE 390 >ref|XP_016171421.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Arachis ipaensis] Length = 365 Score = 84.3 bits (207), Expect = 8e-15 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLCREGR D AF+LLDEC+KRDV+M+EKMYK L +L ++C++ Sbjct: 313 LTYKTVLEGLCREGRADGAFDLLDECRKRDVNMNEKMYKALLRELHYICRE 363 >ref|XP_015936999.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Arachis duranensis] Length = 365 Score = 84.3 bits (207), Expect = 8e-15 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLCREGR D AF+LLDEC+KRDV+M+EKMYK L +L ++C++ Sbjct: 313 LTYKTVLEGLCREGRADGAFDLLDECRKRDVNMNEKMYKALLRELHYICRE 363 >ref|XP_019434617.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Lupinus angustifolius] gb|OIV89443.1| hypothetical protein TanjilG_21886 [Lupinus angustifolius] Length = 374 Score = 82.8 bits (203), Expect = 3e-14 Identities = 34/51 (66%), Positives = 45/51 (88%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLCREG+ DEAFELLDEC+K+DV ++++ YK L N+L ++CQ+ Sbjct: 324 LTYKTVLEGLCREGKADEAFELLDECRKKDVVLNDRTYKTLLNELHYICQE 374 >ref|XP_020968859.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Arachis ipaensis] Length = 172 Score = 79.0 bits (193), Expect = 4e-14 Identities = 33/51 (64%), Positives = 45/51 (88%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLC +GR +EAF+LLDEC+KR+V+M+EKMYK L +L ++C++ Sbjct: 120 LTYKTVLEGLCPKGRANEAFDLLDECRKRNVNMNEKMYKALLRELHYICRE 170 >ref|XP_017434945.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Vigna angularis] gb|KOM53591.1| hypothetical protein LR48_Vigan09g225000 [Vigna angularis] dbj|BAT87291.1| hypothetical protein VIGAN_05064600 [Vigna angularis var. angularis] Length = 371 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLCREGRVD+AFELLDE KKRD SM EKMY L + L F C++ Sbjct: 321 LTYKTVLEGLCREGRVDDAFELLDEWKKRDASMGEKMYVSLLDGLHFSCRE 371 >ref|XP_014517645.2| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Vigna radiata var. radiata] Length = 391 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLCREGRVD+AFELLDE KKRD SM EKMY L + L F C++ Sbjct: 341 LTYKTVLEGLCREGRVDDAFELLDEWKKRDASMGEKMYVSLLDGLHFSCRE 391 >ref|XP_002534359.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Ricinus communis] gb|EEF28024.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 382 Score = 78.6 bits (192), Expect = 1e-12 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTY+TVLEGLCREG+ DEAFELL+E +KRD+SMS+K YK+L N L+FV +D Sbjct: 332 LTYRTVLEGLCREGKTDEAFELLEEFRKRDMSMSQKTYKILLNALQFVNRD 382 >ref|XP_021655305.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Hevea brasiliensis] Length = 395 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKTVLEGLCREG+ DEAFELL+EC+KRD MS+K YK L N L F+ Q+ Sbjct: 345 LTYKTVLEGLCREGKSDEAFELLEECRKRDRLMSQKTYKTLLNSLHFLNQE 395 >ref|XP_021633620.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Manihot esculenta] gb|OAY32870.1| hypothetical protein MANES_13G051900 [Manihot esculenta] Length = 397 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = -1 Query: 892 LTYKTVLEGLCREGRVDEAFELLDECKKRDVSMSEKMYKVLFNDLRFVCQD 740 LTYKT+LEGLCREG+ DEAFELL+EC+K+D MS+K YK L N L F+ Q+ Sbjct: 347 LTYKTLLEGLCREGKSDEAFELLEECRKKDRLMSQKTYKTLLNSLHFLNQE 397