BLASTX nr result
ID: Astragalus23_contig00018503
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00018503 (673 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY14878.1| telomerase-binding protein EST1A, partial [Trifol... 62 2e-07 dbj|GAU32809.1| hypothetical protein TSUD_152580 [Trifolium subt... 61 4e-07 ref|XP_013442442.1| telomerase activating protein Est1 [Medicago... 55 1e-06 >gb|PNY14878.1| telomerase-binding protein EST1A, partial [Trifolium pratense] Length = 1006 Score = 61.6 bits (148), Expect = 2e-07 Identities = 37/65 (56%), Positives = 42/65 (64%), Gaps = 2/65 (3%) Frame = -2 Query: 639 GLLRMCCILTL--QTPTLLPCYWMLLEFLWP*LVRGCLLLQKIMRSSSAGMKEDNQAALQ 466 GLLRMCCIL L QTP L PCYW L + LLL+KIM SSSA KED +A+L Sbjct: 945 GLLRMCCILLLLVQTPALQPCYWSSLALTCCRI----LLLRKIMLSSSARTKEDKRASLL 1000 Query: 465 FKLYK 451 FK+ K Sbjct: 1001 FKVLK 1005 >dbj|GAU32809.1| hypothetical protein TSUD_152580 [Trifolium subterraneum] Length = 996 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/48 (60%), Positives = 32/48 (66%), Gaps = 2/48 (4%) Frame = -3 Query: 635 YCECAASL--HFKLQLCCLVIGCCWSSFGLDLLEAVCYYKRLCGALQP 498 YC+CAAS FKLQLC LVIGCCWSSFGLDLL+ + K P Sbjct: 945 YCKCAASFCYSFKLQLCSLVIGCCWSSFGLDLLQDIATTKDYAELFSP 992 >ref|XP_013442442.1| telomerase activating protein Est1 [Medicago truncatula] gb|KEH16467.1| telomerase activating protein Est1 [Medicago truncatula] Length = 1040 Score = 54.7 bits (130), Expect(2) = 1e-06 Identities = 28/40 (70%), Positives = 29/40 (72%), Gaps = 2/40 (5%) Frame = -3 Query: 635 YCECAASL--HFKLQLCCLVIGCCWSSFGLDLLEAVCYYK 522 YC AAS FKLQLC LVIGCCWSSFGLDLL+ V K Sbjct: 976 YCGWAASFCYSFKLQLCGLVIGCCWSSFGLDLLQDVATTK 1015 Score = 26.2 bits (56), Expect(2) = 1e-06 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 507 SSAGMKEDNQAALQFKLYK 451 S A KED QA+LQFK+ K Sbjct: 1021 SQARTKEDKQASLQFKVLK 1039