BLASTX nr result
ID: Astragalus23_contig00018012
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00018012 (702 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003628165.1| hypothetical protein MTR_8g045020 [Medicago ... 61 1e-08 gb|PNX78444.1| hypothetical protein L195_g034422, partial [Trifo... 59 1e-07 >ref|XP_003628165.1| hypothetical protein MTR_8g045020 [Medicago truncatula] ref|XP_013443130.1| hypothetical protein MTR_0037s0010 [Medicago truncatula] gb|AET02641.1| hypothetical protein MTR_8g045020 [Medicago truncatula] gb|KEH17155.1| hypothetical protein MTR_0037s0010 [Medicago truncatula] Length = 93 Score = 60.8 bits (146), Expect = 1e-08 Identities = 33/55 (60%), Positives = 37/55 (67%) Frame = -1 Query: 399 TSKIASFVNAGLLSGEQASVAVEHFGAAAHGLFAVEMWLGLMDDKKIDYIKSLRR 235 +SKI SFV GLLS EQ VA HF A G+ V+MWLG D KK+DYIKSL R Sbjct: 5 SSKIRSFVGNGLLSNEQGMVAARHFDAKHFGI-EVDMWLGFDDAKKVDYIKSLCR 58 >gb|PNX78444.1| hypothetical protein L195_g034422, partial [Trifolium pratense] Length = 111 Score = 58.5 bits (140), Expect = 1e-07 Identities = 35/73 (47%), Positives = 42/73 (57%) Frame = -1 Query: 417 DLRRSATSKIASFVNAGLLSGEQASVAVEHFGAAAHGLFAVEMWLGLMDDKKIDYIKSLR 238 DL +SKI SFV GLLS EQ VA HF A G+ V+MWL + +K+DYIKSL Sbjct: 30 DLMGMVSSKIRSFVRKGLLSNEQGMVAARHFDAKHFGI-EVDMWLIFENAEKVDYIKSLC 88 Query: 237 RQDTKQLKLTPRR 199 R +L P R Sbjct: 89 RVKEGAHQLMPTR 101