BLASTX nr result
ID: Astragalus23_contig00017936
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00017936 (329 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006589520.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-08 dbj|GAU32340.1| hypothetical protein TSUD_43820 [Trifolium subte... 60 3e-08 gb|OIW12537.1| hypothetical protein TanjilG_04701 [Lupinus angus... 60 4e-08 ref|XP_019442105.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-08 gb|KYP74842.1| hypothetical protein KK1_007535 [Cajanus cajan] 59 7e-08 ref|XP_020232226.1| pentatricopeptide repeat-containing protein ... 59 7e-08 gb|KHN12930.1| Pentatricopeptide repeat-containing protein, chlo... 59 9e-08 ref|XP_004496516.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-07 ref|XP_007143480.1| hypothetical protein PHAVU_007G075500g [Phas... 56 1e-06 ref|XP_003592182.1| pentatricopeptide (PPR) repeat protein [Medi... 55 3e-06 ref|XP_014512833.1| pentatricopeptide repeat-containing protein ... 54 7e-06 ref|XP_017413582.1| PREDICTED: pentatricopeptide repeat-containi... 54 7e-06 dbj|BAT94262.1| hypothetical protein VIGAN_08084600 [Vigna angul... 53 1e-05 >ref|XP_006589520.1| PREDICTED: pentatricopeptide repeat-containing protein At5g52850, chloroplastic-like [Glycine max] gb|KRH35229.1| hypothetical protein GLYMA_10G230100 [Glycine max] Length = 881 Score = 61.2 bits (147), Expect = 1e-08 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = +1 Query: 187 NLCDFDAK*FGVNQACHLFDEMSYRDVVSWATVLSAHTRNQPNF 318 NL AK FGV QA HLFDEM +RDVVSW T+LSAHTRN+ +F Sbjct: 56 NLLCLYAKCFGVGQARHLFDEMPHRDVVSWTTLLSAHTRNKHHF 99 >dbj|GAU32340.1| hypothetical protein TSUD_43820 [Trifolium subterraneum] Length = 630 Score = 60.5 bits (145), Expect = 3e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 172 VFVVLNLCDFDAK*FGVNQACHLFDEMSYRDVVSWATVLSAHTRNQPNF 318 +++ NL AK FGV+QA HLFDEM RDVVSW TVLS+HT+N+ +F Sbjct: 53 LYLTNNLLSLYAKCFGVHQARHLFDEMPDRDVVSWTTVLSSHTKNKHHF 101 >gb|OIW12537.1| hypothetical protein TanjilG_04701 [Lupinus angustifolius] Length = 836 Score = 60.1 bits (144), Expect = 4e-08 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = +1 Query: 187 NLCDFDAK*FGVNQACHLFDEMSYRDVVSWATVLSAHTRNQPNF 318 NL AK FGV A HLFDEM YRDVVSW +LSAHTRN+ +F Sbjct: 12 NLLSLYAKCFGVVTARHLFDEMPYRDVVSWTAILSAHTRNKQHF 55 >ref|XP_019442105.1| PREDICTED: pentatricopeptide repeat-containing protein At5g52850, chloroplastic [Lupinus angustifolius] Length = 888 Score = 60.1 bits (144), Expect = 4e-08 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = +1 Query: 187 NLCDFDAK*FGVNQACHLFDEMSYRDVVSWATVLSAHTRNQPNF 318 NL AK FGV A HLFDEM YRDVVSW +LSAHTRN+ +F Sbjct: 64 NLLSLYAKCFGVVTARHLFDEMPYRDVVSWTAILSAHTRNKQHF 107 >gb|KYP74842.1| hypothetical protein KK1_007535 [Cajanus cajan] Length = 625 Score = 59.3 bits (142), Expect = 7e-08 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = +1 Query: 187 NLCDFDAK*FGVNQACHLFDEMSYRDVVSWATVLSAHTRNQPNF 318 NL AK FGV QA H FDEM ++DVVSW T+LSAHTRN +F Sbjct: 56 NLLSLYAKCFGVRQARHFFDEMPHKDVVSWTTLLSAHTRNNHHF 99 >ref|XP_020232226.1| pentatricopeptide repeat-containing protein At5g52850, chloroplastic [Cajanus cajan] Length = 853 Score = 59.3 bits (142), Expect = 7e-08 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = +1 Query: 187 NLCDFDAK*FGVNQACHLFDEMSYRDVVSWATVLSAHTRNQPNF 318 NL AK FGV QA H FDEM ++DVVSW T+LSAHTRN +F Sbjct: 57 NLLSLYAKCFGVRQARHFFDEMPHKDVVSWTTLLSAHTRNNHHF 100 >gb|KHN12930.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 610 Score = 58.9 bits (141), Expect = 9e-08 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = +1 Query: 187 NLCDFDAK*FGVNQACHLFDEMSYRDVVSWATVLSAHTRNQPNF 318 NL AK FGV A H FDEM +RDVVSW T+LSAHTRN+ +F Sbjct: 68 NLLSLYAKCFGVRHARHFFDEMPHRDVVSWTTLLSAHTRNKHHF 111 >ref|XP_004496516.1| PREDICTED: pentatricopeptide repeat-containing protein At5g52850, chloroplastic [Cicer arietinum] Length = 885 Score = 56.6 bits (135), Expect = 6e-07 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = +1 Query: 172 VFVVLNLCDFDAK*FGVNQACHLFDEMSYRDVVSWATVLSAHTRNQPNF 318 +++ NL AK FGV QA FDEM Y+DVVSW TVLS+HT+N +F Sbjct: 55 LYLTNNLLSLYAKCFGVFQARQFFDEMPYKDVVSWTTVLSSHTKNNHHF 103 >ref|XP_007143480.1| hypothetical protein PHAVU_007G075500g [Phaseolus vulgaris] gb|ESW15474.1| hypothetical protein PHAVU_007G075500g [Phaseolus vulgaris] Length = 882 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = +1 Query: 187 NLCDFDAK*FGVNQACHLFDEMSYRDVVSWATVLSAHTRNQPNF 318 NL AK FGV A H FDEM ++DVVSW T+LSAHT+N+ +F Sbjct: 57 NLLSLYAKCFGVGTARHFFDEMPHKDVVSWTTLLSAHTKNRYHF 100 >ref|XP_003592182.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gb|AES62433.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 912 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = +1 Query: 172 VFVVLNLCDFDAK*FGVNQACHLFDEMSYRDVVSWATVLSAHTRNQ 309 +++ NL AK FGV++A HLFDEM RDVVSW T+LS+HT+ + Sbjct: 49 LYLTNNLLSLYAKTFGVHRARHLFDEMPNRDVVSWTTILSSHTKTK 94 >ref|XP_014512833.1| pentatricopeptide repeat-containing protein At5g52850, chloroplastic [Vigna radiata var. radiata] Length = 881 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +1 Query: 187 NLCDFDAK*FGVNQACHLFDEMSYRDVVSWATVLSAHTRNQ 309 NL AK FGV A H FDEM ++DVVSW T+LSAHTR++ Sbjct: 56 NLLSLYAKCFGVGPARHFFDEMPHKDVVSWTTLLSAHTRHR 96 >ref|XP_017413582.1| PREDICTED: pentatricopeptide repeat-containing protein At5g52850, chloroplastic [Vigna angularis] gb|KOM35920.1| hypothetical protein LR48_Vigan02g207000 [Vigna angularis] Length = 884 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +1 Query: 187 NLCDFDAK*FGVNQACHLFDEMSYRDVVSWATVLSAHTRNQ 309 NL AK FGV A H FDEM ++DVVSW T+LSAHTR++ Sbjct: 56 NLLSLYAKCFGVEPARHFFDEMPHKDVVSWTTLLSAHTRHR 96 >dbj|BAT94262.1| hypothetical protein VIGAN_08084600 [Vigna angularis var. angularis] Length = 858 Score = 53.1 bits (126), Expect = 1e-05 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = +1 Query: 187 NLCDFDAK*FGVNQACHLFDEMSYRDVVSWATVLSAHTRN 306 NL AK FGV A H FDEM ++DVVSW T+LSAHTR+ Sbjct: 56 NLLSLYAKCFGVEPARHFFDEMPHKDVVSWTTLLSAHTRH 95