BLASTX nr result
ID: Astragalus23_contig00017528
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00017528 (305 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014629289.1| PREDICTED: uncharacterized protein LOC102659... 52 6e-06 >ref|XP_014629289.1| PREDICTED: uncharacterized protein LOC102659741 [Glycine max] gb|KRH67234.1| hypothetical protein GLYMA_03G155700 [Glycine max] Length = 191 Score = 52.4 bits (124), Expect = 6e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +1 Query: 202 VLPMETLVAMAHHRNQYYTKSKSQGHSRFGSSSP 303 +L METLV +A HRNQ YT+SKSQ H+ FGSSSP Sbjct: 1 MLQMETLVVVAQHRNQCYTRSKSQRHAEFGSSSP 34