BLASTX nr result
ID: Astragalus23_contig00017315
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00017315 (1490 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU48495.1| hypothetical protein TSUD_291810 [Trifolium subt... 68 6e-18 gb|EXB74570.1| hypothetical protein L484_026267 [Morus notabilis] 73 2e-11 ref|YP_009045726.1| orf109a (mitochondrion) [Batis maritima] >gi... 62 3e-10 gb|PHT44909.1| hypothetical protein CQW23_14067 [Capsicum baccatum] 62 4e-08 ref|YP_009049681.1| hypothetical protein (mitochondrion) [Capsic... 62 4e-08 gb|KRH04772.1| hypothetical protein GLYMA_17G185800 [Glycine max] 52 2e-06 gb|PHT31342.1| hypothetical protein CQW23_27679 [Capsicum baccatum] 56 3e-06 >dbj|GAU48495.1| hypothetical protein TSUD_291810 [Trifolium subterraneum] Length = 81 Score = 67.8 bits (164), Expect(2) = 6e-18 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 760 MNDLRAPSFIARSEMSMFPPEPTYVSIKAFFSF 858 MNDLRAPSFIARSEMSMFPPEPTYVSIKAFF F Sbjct: 1 MNDLRAPSFIARSEMSMFPPEPTYVSIKAFFIF 33 Score = 53.5 bits (127), Expect(2) = 6e-18 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 933 LDLNQPTGSVRSPAASAASLTCASYAFARGSI 1028 LDLNQP VRSPAASAASLTCASYAFARGS+ Sbjct: 44 LDLNQP---VRSPAASAASLTCASYAFARGSV 72 >gb|EXB74570.1| hypothetical protein L484_026267 [Morus notabilis] Length = 169 Score = 73.2 bits (178), Expect = 2e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 1381 PPTNNRYPHTPGRVSEPCNRRPFRAVRGALESAAGA 1488 PPTNNRYP TPGRVSEPCNRRPFRAVRGALESAAGA Sbjct: 117 PPTNNRYP-TPGRVSEPCNRRPFRAVRGALESAAGA 151 >ref|YP_009045726.1| orf109a (mitochondrion) [Batis maritima] gb|AIC83329.1| orf109a (mitochondrion) [Batis maritima] Length = 109 Score = 62.4 bits (150), Expect(2) = 3e-10 Identities = 29/56 (51%), Positives = 33/56 (58%) Frame = -1 Query: 1319 HQRIGRLWWDVWHYLIHGSESQGHGRQEVLFAFVRYLNHSSLSLAYLIMFLVLACG 1152 HQRIGR WWDVWHYLIHGS SQGHG RY S L ++++ CG Sbjct: 53 HQRIGRQWWDVWHYLIHGSGSQGHG---------RYCRRFSSDLFLVVIYRFRNCG 99 Score = 32.7 bits (73), Expect(2) = 3e-10 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -2 Query: 1393 YSSAVRSGAPLLNLLTARSRRLIFS 1319 +S + S LLNLLTARSRRLIFS Sbjct: 28 FSRSATSYLSLLNLLTARSRRLIFS 52 >gb|PHT44909.1| hypothetical protein CQW23_14067 [Capsicum baccatum] Length = 107 Score = 61.6 bits (148), Expect = 4e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1405 HTPGRVSEPCNRRPFRAVRGALESAAGA 1488 HTPGRVSEPCNRRPFRAVRGALESAAGA Sbjct: 44 HTPGRVSEPCNRRPFRAVRGALESAAGA 71 >ref|YP_009049681.1| hypothetical protein (mitochondrion) [Capsicum annuum] gb|AIG89912.1| hypothetical protein (mitochondrion) [Capsicum annuum] gb|AIG90039.1| hypothetical protein (mitochondrion) [Capsicum annuum] gb|PHT32048.1| hypothetical protein CQW23_28385 [Capsicum baccatum] gb|PHT94484.1| hypothetical protein T459_02366 [Capsicum annuum] Length = 107 Score = 61.6 bits (148), Expect = 4e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1405 HTPGRVSEPCNRRPFRAVRGALESAAGA 1488 HTPGRVSEPCNRRPFRAVRGALESAAGA Sbjct: 44 HTPGRVSEPCNRRPFRAVRGALESAAGA 71 >gb|KRH04772.1| hypothetical protein GLYMA_17G185800 [Glycine max] Length = 309 Score = 52.0 bits (123), Expect(2) = 2e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +2 Query: 1415 AELVSRVIGDHFARFGGHLSQPPAP 1489 AELVSRVIGDHFARFGGHLSQP AP Sbjct: 53 AELVSRVIGDHFARFGGHLSQPLAP 77 Score = 30.4 bits (67), Expect(2) = 2e-06 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +3 Query: 1317 MEKISRLERAVNKLSR 1364 MEKISRLERAVNKL + Sbjct: 1 MEKISRLERAVNKLKK 16 >gb|PHT31342.1| hypothetical protein CQW23_27679 [Capsicum baccatum] Length = 107 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +1 Query: 1405 HTPGRVSEPCNRRPFRAVRGALESAAGA 1488 H PGRVSE CNRRPFRAVRGALESAAGA Sbjct: 44 HIPGRVSESCNRRPFRAVRGALESAAGA 71