BLASTX nr result
ID: Astragalus23_contig00017253
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00017253 (323 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006288273.1| plant UBX domain-containing protein 4 [Capse... 60 2e-08 ref|XP_020221583.1| plant UBX domain-containing protein 4-like [... 59 5e-08 ref|XP_017437407.1| PREDICTED: plant UBX domain-containing prote... 58 6e-08 ref|XP_013661146.1| plant UBX domain-containing protein 4-like [... 59 9e-08 gb|KHN40854.1| UBA and UBX domain-containing protein [Glycine soja] 58 1e-07 ref|XP_003546168.1| PREDICTED: plant UBX domain-containing prote... 58 1e-07 gb|ACU19568.1| unknown [Glycine max] 58 1e-07 ref|XP_014518441.1| plant UBX domain-containing protein 4 [Vigna... 57 1e-07 ref|XP_017437408.1| PREDICTED: plant UBX domain-containing prote... 57 1e-07 ref|XP_013611538.1| PREDICTED: plant UBX domain-containing prote... 58 1e-07 ref|XP_009114581.1| PREDICTED: plant UBX domain-containing prote... 58 1e-07 emb|CDY16676.1| BnaA09g20540D [Brassica napus] 58 1e-07 ref|XP_011046995.1| PREDICTED: UBA and UBX domain-containing pro... 58 1e-07 ref|XP_006383853.1| hypothetical protein POPTR_0004s00590g [Popu... 58 1e-07 ref|XP_006383854.1| hypothetical protein POPTR_0004s00590g [Popu... 58 1e-07 ref|XP_019439843.1| PREDICTED: plant UBX domain-containing prote... 58 1e-07 ref|XP_021635644.1| plant UBX domain-containing protein 4-like [... 57 1e-07 ref|XP_019439844.1| PREDICTED: plant UBX domain-containing prote... 58 2e-07 ref|XP_019429919.1| PREDICTED: plant UBX domain-containing prote... 58 2e-07 gb|AGV54361.1| UBA and UBX domain-containing protein [Phaseolus ... 58 2e-07 >ref|XP_006288273.1| plant UBX domain-containing protein 4 [Capsella rubella] gb|EOA21171.1| hypothetical protein CARUB_v10001519mg [Capsella rubella] Length = 311 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = +3 Query: 30 SMEQSKLDQHQPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 S E HQP H+IVFWSNGFT+DDGPLR LDDPE Sbjct: 97 SGENVSTGPHQPEPVVHNIVFWSNGFTIDDGPLRKLDDPE 136 >ref|XP_020221583.1| plant UBX domain-containing protein 4-like [Cajanus cajan] gb|KYP62724.1| UBA and UBX domain-containing protein At4g15410 family [Cajanus cajan] Length = 303 Score = 58.5 bits (140), Expect(2) = 5e-08 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +3 Query: 30 SMEQSKLDQHQPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 S E ++ QP A H+I+FWSNGFTV+DGPLR LDDPE Sbjct: 100 SGETTQSTNQQPEAVVHNIIFWSNGFTVNDGPLRRLDDPE 139 Score = 26.2 bits (56), Expect(2) = 5e-08 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 Query: 2 SKSNDVDVIFNGAKQ 46 SK NDVD IFN A+Q Sbjct: 58 SKGNDVDAIFNQARQ 72 >ref|XP_017437407.1| PREDICTED: plant UBX domain-containing protein 4-like isoform X1 [Vigna angularis] Length = 308 Score = 58.2 bits (139), Expect(2) = 6e-08 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +3 Query: 60 QPPAAAHDIVFWSNGFTVDDGPLRNLDDPEKLL*IFVMV 176 QP A H+IVFWSNGFTV+DGPLR LDDPE + VM+ Sbjct: 111 QPEAVVHNIVFWSNGFTVNDGPLRRLDDPENASFLEVML 149 Score = 26.2 bits (56), Expect(2) = 6e-08 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 Query: 2 SKSNDVDVIFNGAKQ 46 SK NDVD IFN A+Q Sbjct: 58 SKGNDVDAIFNQARQ 72 >ref|XP_013661146.1| plant UBX domain-containing protein 4-like [Brassica napus] Length = 303 Score = 58.5 bits (140), Expect = 9e-08 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 60 QPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 QP AH+IVFWSNGFT+DDGPLR LDDPE Sbjct: 109 QPDPVAHNIVFWSNGFTIDDGPLRKLDDPE 138 >gb|KHN40854.1| UBA and UBX domain-containing protein [Glycine soja] Length = 301 Score = 58.2 bits (139), Expect(2) = 1e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 51 DQHQPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 + QP A H+IVFWSNGFTV+DGPLR+LDDPE Sbjct: 105 NNQQPEAVVHNIVFWSNGFTVNDGPLRSLDDPE 137 Score = 25.4 bits (54), Expect(2) = 1e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 Query: 2 SKSNDVDVIFNGAKQ 46 SK NDVD IFN A+Q Sbjct: 55 SKGNDVDEIFNQARQ 69 >ref|XP_003546168.1| PREDICTED: plant UBX domain-containing protein 4 [Glycine max] gb|KRH11494.1| hypothetical protein GLYMA_15G112000 [Glycine max] Length = 301 Score = 58.2 bits (139), Expect(2) = 1e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 51 DQHQPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 + QP A H+IVFWSNGFTV+DGPLR+LDDPE Sbjct: 105 NNQQPEAVVHNIVFWSNGFTVNDGPLRSLDDPE 137 Score = 25.4 bits (54), Expect(2) = 1e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 Query: 2 SKSNDVDVIFNGAKQ 46 SK NDVD IFN A+Q Sbjct: 55 SKGNDVDEIFNQARQ 69 >gb|ACU19568.1| unknown [Glycine max] Length = 301 Score = 58.2 bits (139), Expect(2) = 1e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 51 DQHQPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 + QP A H+IVFWSNGFTV+DGPLR+LDDPE Sbjct: 105 NNQQPEAVVHNIVFWSNGFTVNDGPLRSLDDPE 137 Score = 25.4 bits (54), Expect(2) = 1e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 Query: 2 SKSNDVDVIFNGAKQ 46 SK NDVD IFN A+Q Sbjct: 55 SKGNDVDEIFNQARQ 69 >ref|XP_014518441.1| plant UBX domain-containing protein 4 [Vigna radiata var. radiata] Length = 297 Score = 57.4 bits (137), Expect(2) = 1e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 60 QPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 QP A H+IVFWSNGFTV+DGPLR LDDPE Sbjct: 111 QPEAVVHNIVFWSNGFTVNDGPLRRLDDPE 140 Score = 26.2 bits (56), Expect(2) = 1e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 Query: 2 SKSNDVDVIFNGAKQ 46 SK NDVD IFN A+Q Sbjct: 58 SKGNDVDAIFNQARQ 72 >ref|XP_017437408.1| PREDICTED: plant UBX domain-containing protein 4-like isoform X2 [Vigna angularis] gb|KOM53286.1| hypothetical protein LR48_Vigan09g194500 [Vigna angularis] dbj|BAT87504.1| hypothetical protein VIGAN_05088200 [Vigna angularis var. angularis] Length = 297 Score = 57.4 bits (137), Expect(2) = 1e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 60 QPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 QP A H+IVFWSNGFTV+DGPLR LDDPE Sbjct: 111 QPEAVVHNIVFWSNGFTVNDGPLRRLDDPE 140 Score = 26.2 bits (56), Expect(2) = 1e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 Query: 2 SKSNDVDVIFNGAKQ 46 SK NDVD IFN A+Q Sbjct: 58 SKGNDVDAIFNQARQ 72 >ref|XP_013611538.1| PREDICTED: plant UBX domain-containing protein 4-like [Brassica oleracea var. oleracea] ref|XP_013662046.1| plant UBX domain-containing protein 4-like [Brassica napus] ref|XP_013662052.1| plant UBX domain-containing protein 4-like [Brassica napus] Length = 302 Score = 58.2 bits (139), Expect = 1e-07 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +3 Query: 60 QPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 QP AH+I+FWSNGFT+DDGPLR LDDPE Sbjct: 109 QPDPVAHNIIFWSNGFTIDDGPLRKLDDPE 138 >ref|XP_009114581.1| PREDICTED: plant UBX domain-containing protein 4-like [Brassica rapa] Length = 303 Score = 58.2 bits (139), Expect = 1e-07 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +3 Query: 60 QPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 QP AH+I+FWSNGFT+DDGPLR LDDPE Sbjct: 109 QPDPVAHNIIFWSNGFTIDDGPLRKLDDPE 138 >emb|CDY16676.1| BnaA09g20540D [Brassica napus] Length = 303 Score = 58.2 bits (139), Expect = 1e-07 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +3 Query: 60 QPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 QP AH+I+FWSNGFT+DDGPLR LDDPE Sbjct: 109 QPDPVAHNIIFWSNGFTIDDGPLRKLDDPE 138 >ref|XP_011046995.1| PREDICTED: UBA and UBX domain-containing protein At4g15410-like [Populus euphratica] Length = 305 Score = 58.2 bits (139), Expect = 1e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 60 QPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 QP A H+IVFW+NGFTVDDGPLR LDDPE Sbjct: 111 QPEAVVHNIVFWTNGFTVDDGPLRRLDDPE 140 >ref|XP_006383853.1| hypothetical protein POPTR_0004s00590g [Populus trichocarpa] gb|ABK96017.1| unknown [Populus trichocarpa] gb|PNT38920.1| hypothetical protein POPTR_004G004200v3 [Populus trichocarpa] Length = 305 Score = 58.2 bits (139), Expect = 1e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 60 QPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 QP A H+IVFW+NGFTVDDGPLR LDDPE Sbjct: 111 QPEAVVHNIVFWTNGFTVDDGPLRRLDDPE 140 >ref|XP_006383854.1| hypothetical protein POPTR_0004s00590g [Populus trichocarpa] gb|PNT38919.1| hypothetical protein POPTR_004G004200v3 [Populus trichocarpa] Length = 309 Score = 58.2 bits (139), Expect = 1e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 60 QPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 QP A H+IVFW+NGFTVDDGPLR LDDPE Sbjct: 111 QPEAVVHNIVFWTNGFTVDDGPLRRLDDPE 140 >ref|XP_019439843.1| PREDICTED: plant UBX domain-containing protein 4-like [Lupinus angustifolius] Length = 253 Score = 57.8 bits (138), Expect = 1e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 60 QPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 QP A H+IVFWSNGFTV+DGPLR+LDDPE Sbjct: 59 QPEAVVHNIVFWSNGFTVNDGPLRSLDDPE 88 >ref|XP_021635644.1| plant UBX domain-containing protein 4-like [Hevea brasiliensis] Length = 304 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 60 QPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 QP A H+IVFWSNGFTV+DGPLR LDDPE Sbjct: 110 QPEAVIHNIVFWSNGFTVNDGPLRRLDDPE 139 Score = 26.2 bits (56), Expect(2) = 1e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 Query: 2 SKSNDVDVIFNGAKQ 46 SK NDVD IFN A+Q Sbjct: 58 SKGNDVDAIFNQARQ 72 >ref|XP_019439844.1| PREDICTED: plant UBX domain-containing protein 4-like [Lupinus angustifolius] gb|OIW14008.1| hypothetical protein TanjilG_09359 [Lupinus angustifolius] Length = 301 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 60 QPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 QP A H+IVFWSNGFTV+DGPLR+LDDPE Sbjct: 107 QPEAVVHNIVFWSNGFTVNDGPLRSLDDPE 136 >ref|XP_019429919.1| PREDICTED: plant UBX domain-containing protein 4-like [Lupinus angustifolius] gb|OIW19845.1| hypothetical protein TanjilG_27202 [Lupinus angustifolius] Length = 304 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 60 QPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 QP A H+IVFWSNGFTV+DGPLR+LDDPE Sbjct: 110 QPEAVVHNIVFWSNGFTVNDGPLRSLDDPE 139 >gb|AGV54361.1| UBA and UBX domain-containing protein [Phaseolus vulgaris] Length = 304 Score = 57.8 bits (138), Expect = 2e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +3 Query: 39 QSKLDQHQPPAAAHDIVFWSNGFTVDDGPLRNLDDPE 149 QS +Q QP A H+IVFWSNGFTV+DGPLR LDDPE Sbjct: 105 QSTTNQ-QPEAVVHNIVFWSNGFTVNDGPLRRLDDPE 140