BLASTX nr result
ID: Astragalus23_contig00016722
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00016722 (626 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP57814.1| Auxin response factor 19 [Cajanus cajan] 65 2e-08 ref|XP_020225990.1| auxin response factor 19 [Cajanus cajan] >gi... 65 2e-08 gb|PNY05178.1| auxin response factor 19-like protein [Trifolium ... 64 4e-08 gb|KHN07880.1| Auxin response factor 19 [Glycine soja] 64 4e-08 ref|XP_014620925.1| PREDICTED: auxin response factor 19-like [Gl... 64 4e-08 gb|PNY07112.1| auxin response factor 19-like protein, partial [T... 64 4e-08 ref|XP_014508657.1| auxin response factor 19 isoform X4 [Vigna r... 64 4e-08 ref|XP_014508656.1| auxin response factor 19 isoform X2 [Vigna r... 64 4e-08 gb|KHN17743.1| Auxin response factor 7 [Glycine soja] 64 4e-08 ref|XP_021912497.1| auxin response factor 19-like [Carica papaya] 63 5e-08 gb|KOM47659.1| hypothetical protein LR48_Vigan07g136300 [Vigna a... 63 7e-08 ref|XP_017428692.1| PREDICTED: auxin response factor 19 [Vigna a... 63 7e-08 gb|POE57673.1| auxin response factor 19 [Quercus suber] 62 9e-08 ref|XP_002324725.1| auxin response factor 1 family protein [Popu... 62 1e-07 ref|XP_011006171.1| PREDICTED: auxin response factor 19-like iso... 62 1e-07 gb|PNS92954.1| hypothetical protein POPTR_018G063000v3 [Populus ... 62 1e-07 ref|XP_004488112.1| PREDICTED: auxin response factor 19-like iso... 62 1e-07 ref|XP_003551063.1| PREDICTED: auxin response factor 19-like iso... 62 1e-07 ref|XP_023895176.1| auxin response factor 19-like [Quercus suber] 62 1e-07 ref|XP_013458391.1| auxin response factor 2 [Medicago truncatula... 62 2e-07 >gb|KYP57814.1| Auxin response factor 19 [Cajanus cajan] Length = 987 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MK PSNGYLPNSGEGERKSINSELWHACA Sbjct: 1 MKAPSNGYLPNSGEGERKSINSELWHACA 29 >ref|XP_020225990.1| auxin response factor 19 [Cajanus cajan] ref|XP_020225991.1| auxin response factor 19 [Cajanus cajan] Length = 1125 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MK PSNGYLPNSGEGERKSINSELWHACA Sbjct: 1 MKAPSNGYLPNSGEGERKSINSELWHACA 29 >gb|PNY05178.1| auxin response factor 19-like protein [Trifolium pratense] Length = 1125 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MK PSNGYLPNSGEGERK+INSELWHACA Sbjct: 1 MKAPSNGYLPNSGEGERKAINSELWHACA 29 >gb|KHN07880.1| Auxin response factor 19 [Glycine soja] Length = 1130 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MK PSNGYLPNSGEGERK+INSELWHACA Sbjct: 1 MKAPSNGYLPNSGEGERKTINSELWHACA 29 >ref|XP_014620925.1| PREDICTED: auxin response factor 19-like [Glycine max] gb|KRH19355.1| hypothetical protein GLYMA_13G112600 [Glycine max] Length = 1131 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MK PSNGYLPNSGEGERK+INSELWHACA Sbjct: 1 MKAPSNGYLPNSGEGERKTINSELWHACA 29 >gb|PNY07112.1| auxin response factor 19-like protein, partial [Trifolium pratense] gb|PNY07379.1| auxin response factor 19-like protein, partial [Trifolium pratense] Length = 1144 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 486 VAMKVPSNGYLPNSGEGERKSINSELWHACA 578 V MK PSNGYLPNSG+GERK+INSELWHACA Sbjct: 1 VLMKAPSNGYLPNSGDGERKTINSELWHACA 31 >ref|XP_014508657.1| auxin response factor 19 isoform X4 [Vigna radiata var. radiata] Length = 1144 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MKVPSNG+LPNSGEGERK+INSELWHACA Sbjct: 1 MKVPSNGFLPNSGEGERKTINSELWHACA 29 >ref|XP_014508656.1| auxin response factor 19 isoform X2 [Vigna radiata var. radiata] Length = 1150 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MKVPSNG+LPNSGEGERK+INSELWHACA Sbjct: 1 MKVPSNGFLPNSGEGERKTINSELWHACA 29 >gb|KHN17743.1| Auxin response factor 7 [Glycine soja] Length = 1189 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 486 VAMKVPSNGYLPNSGEGERKSINSELWHACA 578 V MK PSNGYLPNSGEGERK++NSELWHACA Sbjct: 51 VIMKAPSNGYLPNSGEGERKTMNSELWHACA 81 >ref|XP_021912497.1| auxin response factor 19-like [Carica papaya] Length = 987 Score = 63.2 bits (152), Expect = 5e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MK PSNG+LPNSGEGERKSINSELWHACA Sbjct: 1 MKAPSNGFLPNSGEGERKSINSELWHACA 29 >gb|KOM47659.1| hypothetical protein LR48_Vigan07g136300 [Vigna angularis] Length = 953 Score = 62.8 bits (151), Expect = 7e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MKVPSNG+LPNSGEGERK INSELWHACA Sbjct: 1 MKVPSNGFLPNSGEGERKPINSELWHACA 29 >ref|XP_017428692.1| PREDICTED: auxin response factor 19 [Vigna angularis] Length = 1111 Score = 62.8 bits (151), Expect = 7e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MKVPSNG+LPNSGEGERK INSELWHACA Sbjct: 1 MKVPSNGFLPNSGEGERKPINSELWHACA 29 >gb|POE57673.1| auxin response factor 19 [Quercus suber] Length = 355 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MKVP NG+LPNSGEGE+KSINSELWHACA Sbjct: 1 MKVPQNGFLPNSGEGEKKSINSELWHACA 29 >ref|XP_002324725.1| auxin response factor 1 family protein [Populus trichocarpa] gb|PNS92953.1| hypothetical protein POPTR_018G063000v3 [Populus trichocarpa] Length = 1047 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MKVPSNG+LPNS EGERKSINSELWHACA Sbjct: 1 MKVPSNGFLPNSAEGERKSINSELWHACA 29 >ref|XP_011006171.1| PREDICTED: auxin response factor 19-like isoform X2 [Populus euphratica] Length = 1095 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MKVPSNG+LPNS EGERKSINSELWHACA Sbjct: 1 MKVPSNGFLPNSAEGERKSINSELWHACA 29 >gb|PNS92954.1| hypothetical protein POPTR_018G063000v3 [Populus trichocarpa] Length = 1106 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MKVPSNG+LPNS EGERKSINSELWHACA Sbjct: 1 MKVPSNGFLPNSAEGERKSINSELWHACA 29 >ref|XP_004488112.1| PREDICTED: auxin response factor 19-like isoform X1 [Cicer arietinum] Length = 1120 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MK PSNGYLPNSGEGERK+IN+ELWHACA Sbjct: 1 MKAPSNGYLPNSGEGERKTINTELWHACA 29 >ref|XP_003551063.1| PREDICTED: auxin response factor 19-like isoform X1 [Glycine max] gb|KRH02575.1| hypothetical protein GLYMA_17G047100 [Glycine max] Length = 1136 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MK PSNGYLPNSGEGERK++NSELWHACA Sbjct: 1 MKAPSNGYLPNSGEGERKTMNSELWHACA 29 >ref|XP_023895176.1| auxin response factor 19-like [Quercus suber] Length = 537 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MKVP NG+LPNSGEGE+KSINSELWHACA Sbjct: 1 MKVPQNGFLPNSGEGEKKSINSELWHACA 29 >ref|XP_013458391.1| auxin response factor 2 [Medicago truncatula] gb|KEH32422.1| auxin response factor 2 [Medicago truncatula] Length = 1097 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 492 MKVPSNGYLPNSGEGERKSINSELWHACA 578 MK P+NGY+PNSGEGERK+INSELWHACA Sbjct: 1 MKAPNNGYMPNSGEGERKTINSELWHACA 29