BLASTX nr result
ID: Astragalus23_contig00016192
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00016192 (375 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008235724.1| PREDICTED: zinc finger protein 346-like [Pru... 56 1e-06 ref|XP_020425179.1| uncharacterized protein LOC18768621 isoform ... 56 2e-06 ref|XP_007199105.2| uncharacterized protein LOC18768621 isoform ... 56 2e-06 ref|XP_021814739.1| zinc finger protein 346-like [Prunus avium] 54 8e-06 >ref|XP_008235724.1| PREDICTED: zinc finger protein 346-like [Prunus mume] Length = 390 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/59 (44%), Positives = 36/59 (61%) Frame = -1 Query: 360 KGILVMDPKPKVQKPQQNLSELFRMKGSNFKCVVCDVILQSESSVASHFKGKKHLANIQ 184 K I++M+ K VQ QQN +E RMKGS C +C V E+ +ASH G++H N+Q Sbjct: 187 KKIIIMNFKENVQCQQQNTNEALRMKGSRLWCNICSVRCPGETDMASHLSGRRHKENVQ 245 >ref|XP_020425179.1| uncharacterized protein LOC18768621 isoform X2 [Prunus persica] Length = 431 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/59 (45%), Positives = 35/59 (59%) Frame = -1 Query: 360 KGILVMDPKPKVQKPQQNLSELFRMKGSNFKCVVCDVILQSESSVASHFKGKKHLANIQ 184 K I++M+ K VQ QQN +E RMKGS C VC V E +ASH G++H N+Q Sbjct: 182 KKIIIMNFKENVQGQQQNTNEALRMKGSRLWCNVCSVRCPGEIDMASHLSGRRHKENVQ 240 >ref|XP_007199105.2| uncharacterized protein LOC18768621 isoform X1 [Prunus persica] gb|ONH93376.1| hypothetical protein PRUPE_8G228800 [Prunus persica] Length = 436 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/59 (45%), Positives = 35/59 (59%) Frame = -1 Query: 360 KGILVMDPKPKVQKPQQNLSELFRMKGSNFKCVVCDVILQSESSVASHFKGKKHLANIQ 184 K I++M+ K VQ QQN +E RMKGS C VC V E +ASH G++H N+Q Sbjct: 187 KKIIIMNFKENVQGQQQNTNEALRMKGSRLWCNVCSVRCPGEIDMASHLSGRRHKENVQ 245 >ref|XP_021814739.1| zinc finger protein 346-like [Prunus avium] Length = 390 Score = 53.9 bits (128), Expect = 8e-06 Identities = 24/56 (42%), Positives = 35/56 (62%) Frame = -1 Query: 351 LVMDPKPKVQKPQQNLSELFRMKGSNFKCVVCDVILQSESSVASHFKGKKHLANIQ 184 L+M+ K VQ Q+N++E+ RMKGS C +C V E +ASH G++H N+Q Sbjct: 190 LIMNFKENVQGQQRNINEVLRMKGSRLWCNICSVSCPGEIDMASHLSGRQHKENVQ 245