BLASTX nr result
ID: Astragalus23_contig00016054
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00016054 (991 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013460699.1| AT hook motif DNA-binding family protein [Me... 59 4e-06 >ref|XP_013460699.1| AT hook motif DNA-binding family protein [Medicago truncatula] gb|KEH34733.1| AT hook motif DNA-binding family protein [Medicago truncatula] Length = 313 Score = 58.9 bits (141), Expect = 4e-06 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 2/36 (5%) Frame = +3 Query: 888 WWAGNVGMSHRETMPSSPS--LQLKREQEFMENNNN 989 WW GNV M HRE+MPSSPS LKREQE MENNNN Sbjct: 5 WWTGNVAMGHRESMPSSPSSLQHLKREQELMENNNN 40