BLASTX nr result
ID: Astragalus23_contig00016024
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00016024 (1516 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003599578.1| NAD(P)H-quinone oxidoreductase subunit 2 [Me... 404 e-128 ref|YP_009175803.1| ribosomal protein S7 (chloroplast) [Astragal... 302 2e-98 gb|AJE71771.1| ribosomal protein S7 (plastid) [Astragalus canade... 300 3e-97 ref|NP_001238194.1| ribosomal protein S7 [Glycine max] >gi|25562... 299 7e-97 ref|YP_009429929.1| ribosomal protein S7 (plastid) [Carmichaelia... 298 1e-96 ref|YP_009440639.1| ribosomal protein S7 (chloroplast) [Lesserti... 297 2e-96 gb|AJE72268.1| ribosomal protein S7 (plastid) [Oxytropis lambertii] 296 4e-96 ref|YP_009334233.1| ribosomal protein S7 (chloroplast) [Caragana... 292 3e-94 ref|YP_009402399.1| ribosomal protein S7 (chloroplast) [Dichrost... 290 2e-93 ref|NP_084841.1| ribosomal protein S7 [Lotus japonicus] >gi|1351... 289 3e-93 ref|YP_009460211.1| ribosomal protein S7 (chloroplast) [Dalbergi... 289 3e-93 gb|AMC32667.1| ribosomal protein S7 (chloroplast) [Lespedeza cap... 289 4e-93 gb|AJE71629.1| ribosomal protein S7 (plastid) [Melilotus officin... 289 4e-93 ref|YP_009241792.1| ribosomal protein S7 (plastid) [Tofieldia th... 289 4e-93 ref|YP_009028098.1| ribosomal protein S7 (chloroplast) (chloropl... 288 6e-93 ref|YP_009141653.1| ribosomal protein S7 (chloroplast) [Medicago... 288 1e-92 gb|AHY33103.1| ribosomal protein S7 (chloroplast) [Indigofera ti... 288 1e-92 gb|ACF33402.1| ribosomal protein S7 (chloroplast) [Gonystylus ba... 288 1e-92 ref|WP_064723896.1| 30S ribosomal protein S7 [Paenarthrobacter n... 288 1e-92 ref|YP_009440889.1| ribosomal protein S7 (plastid) [Japonolirion... 288 1e-92 >ref|XP_003599578.1| NAD(P)H-quinone oxidoreductase subunit 2 [Medicago truncatula] gb|AES69829.1| NAD(P)H-quinone oxidoreductase subunit 2 [Medicago truncatula] Length = 871 Score = 404 bits (1039), Expect = e-128 Identities = 224/295 (75%), Positives = 232/295 (78%), Gaps = 2/295 (0%) Frame = +1 Query: 157 KDPLTSKELNEEPYEVKISCTVL*SGSKDDLLILSVNFSTITPKKPNSALRKVARVRLTS 336 KDP+TSKELNE+ KDDL SVNFSTITPKKPNSALRKVARVRLTS Sbjct: 67 KDPITSKELNED---------------KDDL---SVNFSTITPKKPNSALRKVARVRLTS 108 Query: 337 GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRKQGRSKYGA 516 GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDR+Q Sbjct: 109 GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQ------- 161 Query: 517 KKPK*MILAPISYKKWITPLTLMSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSL 696 GT EKKTAKSDPIYRNRLVNMLVNRIMK GKKSL Sbjct: 162 --------------------------GTAEKKTAKSDPIYRNRLVNMLVNRIMKHGKKSL 195 Query: 697 AYQIIYRAMKRIQQKTEKNPLSVLRQAIRGVTPDIVV--KARRVGGSTHQVPIEIGSTQG 870 AYQIIYRAMKRIQQKT+ NPL VLRQAIRGVTPDI V K RRV GS +VP+EIGSTQG Sbjct: 196 AYQIIYRAMKRIQQKTKTNPLYVLRQAIRGVTPDIAVKTKTRRVSGSNKKVPVEIGSTQG 255 Query: 871 KALAIRWLLGASRKRPGRNMAFKLSSELLDAVKGSGDAIRKKEETHRMAEANRAF 1035 KALAIRWLLGASRKRPGRNMAFKLSSEL+DA KGSGDAIRKK+ETHRMAEANRAF Sbjct: 256 KALAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKQETHRMAEANRAF 310 Score = 99.8 bits (247), Expect = 3e-18 Identities = 51/74 (68%), Positives = 54/74 (72%) Frame = +2 Query: 1295 NENLILDSTRIFMKAFHLLLFDGSXXXXXXXXXXXXXXXXXXXXTSDQKDISWFYFISST 1474 NENLIL+STRIFMKAFHLL+FDGS TSDQKD+SWFYFISST Sbjct: 311 NENLILESTRIFMKAFHLLVFDGSFIFPELILIFGLILLLMIDSTSDQKDLSWFYFISST 370 Query: 1475 SLVMSITALLFRWR 1516 SLVMSITALLFRWR Sbjct: 371 SLVMSITALLFRWR 384 >ref|YP_009175803.1| ribosomal protein S7 (chloroplast) [Astragalus mongholicus var. nakaianus] ref|YP_009242997.1| ribosomal protein S7 (chloroplast) [Astragalus mongholicus] gb|ALH42775.1| ribosomal protein S7 (chloroplast) [Astragalus mongholicus var. nakaianus] gb|AMQ99260.1| ribosomal protein S7 (chloroplast) [Astragalus mongholicus] gb|ANK78971.1| ribosomal protein S7 (chloroplast) [Astragalus membranaceus var. membranaceus] Length = 155 Score = 302 bits (774), Expect = 2e-98 Identities = 155/155 (100%), Positives = 155/155 (100%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS Sbjct: 1 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 155 >gb|AJE71771.1| ribosomal protein S7 (plastid) [Astragalus canadensis] Length = 155 Score = 300 bits (767), Expect = 3e-97 Identities = 154/155 (99%), Positives = 154/155 (99%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMK GKKSLAYQIIYRAMKRIQQKTEKNPLS Sbjct: 1 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKHGKKSLAYQIIYRAMKRIQQKTEKNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|NP_001238194.1| ribosomal protein S7 [Glycine max] gb|ACU14175.1| unknown [Glycine max] Length = 173 Score = 299 bits (766), Expect = 7e-97 Identities = 156/173 (90%), Positives = 161/173 (93%), Gaps = 1/173 (0%) Frame = +1 Query: 532 MILAPISY-KKWITPLTLMSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQI 708 MILA I KK I P TLMSRRGT E+KTAKSDPIYRNRLVNMLVNRI+K GKKSLAYQI Sbjct: 1 MILALIKVIKKRIPPFTLMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQI 60 Query: 709 IYRAMKRIQQKTEKNPLSVLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIR 888 IYRAMK+IQQKTE NPLSVLRQAIRGVTPDI VKARRVGGSTHQVP+EIGSTQGKALAIR Sbjct: 61 IYRAMKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPVEIGSTQGKALAIR 120 Query: 889 WLLGASRKRPGRNMAFKLSSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 WLLGASRKRPGRNMAFKLSSEL+DA KGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 WLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 173 >ref|YP_009429929.1| ribosomal protein S7 (plastid) [Carmichaelia australis] gb|ASY01260.1| ribosomal protein S7 (plastid) [Carmichaelia australis] Length = 155 Score = 298 bits (763), Expect = 1e-96 Identities = 153/155 (98%), Positives = 154/155 (99%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMK GKKSLAYQIIY+AMKRIQQKTEKNPLS Sbjct: 1 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKHGKKSLAYQIIYQAMKRIQQKTEKNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009440639.1| ribosomal protein S7 (chloroplast) [Lessertia frutescens] gb|ATG87705.1| ribosomal protein S7 (chloroplast) [Lessertia frutescens] Length = 155 Score = 297 bits (761), Expect = 2e-96 Identities = 153/155 (98%), Positives = 153/155 (98%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRR TVEKKTAKSDPIYRNRLVNMLVNRIMK GKKSLAYQIIYRAMKRIQQKTEKNPLS Sbjct: 1 MSRRSTVEKKTAKSDPIYRNRLVNMLVNRIMKHGKKSLAYQIIYRAMKRIQQKTEKNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 155 >gb|AJE72268.1| ribosomal protein S7 (plastid) [Oxytropis lambertii] Length = 155 Score = 296 bits (759), Expect = 4e-96 Identities = 152/155 (98%), Positives = 153/155 (98%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMK GKK+LAYQIIY AMKRIQQKTEKNPLS Sbjct: 1 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKHGKKALAYQIIYEAMKRIQQKTEKNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009334233.1| ribosomal protein S7 (chloroplast) [Caragana microphylla] ref|YP_009389973.1| ribosomal protein S7 (chloroplast) [Caragana korshinskii] gb|APL97440.1| ribosomal protein S7 (chloroplast) [Caragana microphylla] gb|APL97516.1| ribosomal protein S7 (chloroplast) [Caragana korshinskii] Length = 155 Score = 292 bits (747), Expect = 3e-94 Identities = 150/155 (96%), Positives = 150/155 (96%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGT EKKTAKSDPIYRNRLVNMLVNRIMK GKKSLAYQIIYRAMKRIQQKTE NPLS Sbjct: 1 MSRRGTAEKKTAKSDPIYRNRLVNMLVNRIMKHGKKSLAYQIIYRAMKRIQQKTETNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDI VKARRV GSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVSGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009402399.1| ribosomal protein S7 (chloroplast) [Dichrostachys cinerea] ref|YP_009402412.1| ribosomal protein S7 (chloroplast) [Dichrostachys cinerea] gb|APA33040.1| ribosomal protein S7 (chloroplast) [Dichrostachys cinerea] gb|APA33053.1| ribosomal protein S7 (chloroplast) [Dichrostachys cinerea] Length = 155 Score = 290 bits (741), Expect = 2e-93 Identities = 146/155 (94%), Positives = 151/155 (97%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGT E+KTAKSDPIYRNRLVNMLVNRI+K GKKSLAYQIIYRAMK+IQQKTEKNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTEKNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDI VKARRVGGSTHQVP+EIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPVEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSEL+DA KGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|NP_084841.1| ribosomal protein S7 [Lotus japonicus] ref|NP_084854.1| ribosomal protein S7 [Lotus japonicus] sp|Q9B1A1.1|RR7_LOTJA RecName: Full=30S ribosomal protein S7, chloroplastic dbj|BAB33240.1| ribosomal protein S7 (chloroplast) [Lotus japonicus] dbj|BAB33254.1| ribosomal protein S7 (chloroplast) [Lotus japonicus] gb|AHY33432.1| ribosomal protein S7 (chloroplast) [Robinia pseudoacacia] gb|AHY33446.1| ribosomal protein S7 (chloroplast) [Robinia pseudoacacia] Length = 155 Score = 289 bits (740), Expect = 3e-93 Identities = 147/155 (94%), Positives = 150/155 (96%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGT EKKTAKSDPIYRNRLVNMLVNRI+K GKKSLAYQIIYRAMK+IQQKTE NPLS Sbjct: 1 MSRRGTAEKKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTETNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDI VKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSEL+DA KGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009460211.1| ribosomal protein S7 (chloroplast) [Dalbergia hainanensis] ref|YP_009460228.1| ribosomal protein S7 (chloroplast) [Dalbergia hainanensis] gb|AHY32771.1| ribosomal protein S7 (chloroplast) [Arachis hypogaea] gb|AHY32785.1| ribosomal protein S7 (chloroplast) [Arachis hypogaea] gb|ANJ01557.1| ribosomal protein S7 (chloroplast) [Arachis hypogaea] gb|ANJ01575.1| ribosomal protein S7 (chloroplast) [Arachis hypogaea] gb|ATL23440.1| ribosomal protein S7 (chloroplast) [Dalbergia odorifera] gb|ATL23441.1| ribosomal protein S7 (chloroplast) [Dalbergia odorifera] gb|AUT81350.1| ribosomal protein S7 (chloroplast) [Dalbergia hainanensis] gb|AUT81367.1| ribosomal protein S7 (chloroplast) [Dalbergia hainanensis] Length = 155 Score = 289 bits (740), Expect = 3e-93 Identities = 147/155 (94%), Positives = 151/155 (97%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGTVE+KTAKSDPIYRNRLVNMLVNRI+K GKKSLAYQIIYRAMK+IQQKTE NPLS Sbjct: 1 MSRRGTVEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTETNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDI VKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSEL+DA KGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >gb|AMC32667.1| ribosomal protein S7 (chloroplast) [Lespedeza capitata] Length = 155 Score = 289 bits (739), Expect = 4e-93 Identities = 147/155 (94%), Positives = 150/155 (96%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGT E+KTAKSDPIYRNRLVNMLVNRIMK GKKSLAYQIIYRAMK+IQQKTE NPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRIMKHGKKSLAYQIIYRAMKKIQQKTETNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDI VKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSEL+DA KGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >gb|AJE71629.1| ribosomal protein S7 (plastid) [Melilotus officinalis] gb|AJE71700.1| ribosomal protein S7 (plastid) [Melilotus albus] Length = 155 Score = 289 bits (739), Expect = 4e-93 Identities = 147/155 (94%), Positives = 149/155 (96%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGT EKKTAKSDPIYRNRLVNMLVNRIMK GKKSLAYQIIYRAMKRIQQKTE NPLS Sbjct: 1 MSRRGTAEKKTAKSDPIYRNRLVNMLVNRIMKHGKKSLAYQIIYRAMKRIQQKTETNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDI VKARRV GSTHQVP+EIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVSGSTHQVPVEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSEL+DA KGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009241792.1| ribosomal protein S7 (plastid) [Tofieldia thibetica] ref|YP_009241805.1| ribosomal protein S7 (plastid) [Tofieldia thibetica] gb|AAN31967.1| ribosomal protein S7 (chloroplast) [Triantha glutinosa] gb|AEX01315.1| ribosomal protein S7 (plastid) [Triantha racemosa] gb|AEX01318.1| ribosomal protein S7 (plastid) [Tofieldia coccinea] gb|AEX01321.1| ribosomal protein S7 (plastid) [Harperocallis flava] gb|AMQ13367.1| ribosomal protein S7 (plastid) [Tofieldia thibetica] gb|AMQ13380.1| ribosomal protein S7 (plastid) [Tofieldia thibetica] Length = 155 Score = 289 bits (739), Expect = 4e-93 Identities = 146/155 (94%), Positives = 151/155 (97%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGT E+KTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRA+K+IQQKTE NPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDI VKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSEL+DA KGSGDAIRKKEETH+MAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHKMAEANRAFAHFR 155 >ref|YP_009028098.1| ribosomal protein S7 (chloroplast) (chloroplast) [Licania heteromorpha] ref|YP_009028111.1| ribosomal protein S7 (chloroplast) (chloroplast) [Licania heteromorpha] gb|AHX80818.1| ribosomal protein S7 (chloroplast) [Licania heteromorpha] gb|AHX80819.1| ribosomal protein S7 (chloroplast) [Licania heteromorpha] Length = 155 Score = 288 bits (738), Expect = 6e-93 Identities = 146/155 (94%), Positives = 151/155 (97%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGT E+KTAKSDPIYRNRLVNMLVNRI+K GKKSLAYQIIYRA+K+IQQKTEKNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTEKNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDI VKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSEL+DA KGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009141653.1| ribosomal protein S7 (chloroplast) [Medicago hybrida] ref|YP_009141728.1| ribosomal protein S7 (chloroplast) [Medicago papillosa] ref|YP_009327906.1| ribosomal protein S7 (chloroplast) [Medicago falcata] gb|AIL56178.1| ribosomal protein S7 (chloroplast) [Medicago hybrida] gb|AIL56253.1| ribosomal protein S7 (chloroplast) [Medicago papillosa] gb|AMC32668.1| ribosomal protein S7 (chloroplast) [Medicago sativa] gb|ANS57948.1| ribosomal protein S7 (chloroplast) [Medicago sativa] gb|AOG66163.1| ribosomal protein S7 (chloroplast) [Medicago sativa] gb|APC60450.1| ribosomal protein S7 (chloroplast) [Medicago falcata] Length = 155 Score = 288 bits (736), Expect = 1e-92 Identities = 146/155 (94%), Positives = 149/155 (96%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGT EKKTAKSDPIYRNRLVNMLVNRIMK GKKSLAYQIIYRAMKRIQQKTE NPLS Sbjct: 1 MSRRGTAEKKTAKSDPIYRNRLVNMLVNRIMKHGKKSLAYQIIYRAMKRIQQKTETNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDI VKARRV GSTHQVP+EIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVNGSTHQVPVEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSEL+DA KG+GDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGNGDAIRKKEETHRMAEANRAFAHFR 155 >gb|AHY33103.1| ribosomal protein S7 (chloroplast) [Indigofera tinctoria] gb|AHY33117.1| ribosomal protein S7 (chloroplast) [Indigofera tinctoria] Length = 155 Score = 288 bits (736), Expect = 1e-92 Identities = 146/155 (94%), Positives = 150/155 (96%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGT E+KTAKSDPIYRNRLVNMLVNRI+K GKKSLAYQIIYRAMK+IQQKTE NPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTETNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSEL+DA KGSGDAIRKKEETHRMAEANR FAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRTFAHFR 155 >gb|ACF33402.1| ribosomal protein S7 (chloroplast) [Gonystylus bancanus] Length = 155 Score = 288 bits (736), Expect = 1e-92 Identities = 145/155 (93%), Positives = 150/155 (96%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGT EKKTAKSDPIYRNRLVNMLVNRI+K GKKSLAYQIIYRA+K+IQQKTE NPLS Sbjct: 1 MSRRGTAEKKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRALKKIQQKTETNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDI VKARRVGGSTHQVPIEIGSTQGKALA+RWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAVRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSEL+DA KGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|WP_064723896.1| 30S ribosomal protein S7 [Paenarthrobacter nicotinovorans] ref|YP_636344.1| ribosomal protein S7 (chloroplast) [Eucalyptus globulus subsp. globulus] ref|YP_636359.1| ribosomal protein S7 (chloroplast) [Eucalyptus globulus subsp. globulus] ref|YP_001718482.1| ribosomal protein S7 [Manihot esculenta] ref|YP_001718495.1| ribosomal protein S7 [Manihot esculenta] ref|YP_002720171.1| rps7 [Jatropha curcas] ref|YP_002720158.1| rps7 [Jatropha curcas] ref|YP_003934004.1| ribosomal protein S7 (chloroplast) [Eucalyptus grandis] ref|YP_003934015.1| ribosomal protein S7 (chloroplast) [Eucalyptus grandis] ref|YP_007475665.1| ribosomal protein S7 [Heliconia collinsiana] ref|YP_007475678.1| ribosomal protein S7 [Heliconia collinsiana] ref|YP_007889906.1| ribosomal protein S7 (plastid) [Francoa sonchifolia] ref|YP_007889918.1| ribosomal protein S7 (plastid) [Francoa sonchifolia] ref|YP_008575158.1| ribosomal protein S7 (chloroplast) [Eucalyptus obliqua] ref|YP_008575173.1| ribosomal protein S7 (chloroplast) [Eucalyptus obliqua] ref|YP_008575243.1| ribosomal protein S7 (chloroplast) [Eucalyptus radiata] ref|YP_008575258.1| ribosomal protein S7 (chloroplast) [Eucalyptus radiata] ref|YP_008575328.1| ribosomal protein S7 (chloroplast) [Eucalyptus delegatensis] ref|YP_008575343.1| ribosomal protein S7 (chloroplast) [Eucalyptus delegatensis] ref|YP_008575413.1| ribosomal protein S7 (chloroplast) [Eucalyptus verrucata] ref|YP_008575428.1| ribosomal protein S7 (chloroplast) [Eucalyptus verrucata] ref|YP_008575498.1| ribosomal protein S7 (chloroplast) [Eucalyptus baxteri] ref|YP_008575513.1| ribosomal protein S7 (chloroplast) [Eucalyptus baxteri] ref|YP_008575583.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversifolia] ref|YP_008575598.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversifolia] ref|YP_008575668.1| ribosomal protein S7 (chloroplast) [Eucalyptus sieberi] ref|YP_008575683.1| ribosomal protein S7 (chloroplast) [Eucalyptus sieberi] ref|YP_008575753.1| ribosomal protein S7 (chloroplast) [Eucalyptus elata] ref|YP_008575768.1| ribosomal protein S7 (chloroplast) [Eucalyptus elata] ref|YP_008575838.1| ribosomal protein S7 (chloroplast) [Eucalyptus regnans] ref|YP_008575853.1| ribosomal protein S7 (chloroplast) [Eucalyptus regnans] ref|YP_008575923.1| ribosomal protein S7 (chloroplast) [Eucalyptus umbra] ref|YP_008575938.1| ribosomal protein S7 (chloroplast) [Eucalyptus umbra] ref|YP_008576008.1| ribosomal protein S7 (chloroplast) [Eucalyptus cloeziana] ref|YP_008576023.1| ribosomal protein S7 (chloroplast) [Eucalyptus cloeziana] ref|YP_008576093.1| ribosomal protein S7 (chloroplast) [Eucalyptus patens] ref|YP_008576108.1| ribosomal protein S7 (chloroplast) [Eucalyptus patens] ref|YP_008576178.1| ribosomal protein S7 (chloroplast) [Eucalyptus marginata] ref|YP_008576193.1| ribosomal protein S7 (chloroplast) [Eucalyptus marginata] ref|YP_008576263.1| ribosomal protein S7 (chloroplast) [Eucalyptus curtisii] ref|YP_008576278.1| ribosomal protein S7 (chloroplast) [Eucalyptus curtisii] ref|YP_008576348.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] ref|YP_008576363.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] ref|YP_008576433.1| ribosomal protein S7 (chloroplast) [Eucalyptus polybractea] ref|YP_008576448.1| ribosomal protein S7 (chloroplast) [Eucalyptus polybractea] ref|YP_008576518.1| ribosomal protein S7 (chloroplast) [Eucalyptus cladocalyx] ref|YP_008576533.1| ribosomal protein S7 (chloroplast) [Eucalyptus cladocalyx] ref|YP_008576603.1| ribosomal protein S7 (chloroplast) [Eucalyptus nitens] ref|YP_008576618.1| ribosomal protein S7 (chloroplast) [Eucalyptus nitens] ref|YP_008576688.1| ribosomal protein S7 (chloroplast) [Eucalyptus aromaphloia] ref|YP_008576703.1| ribosomal protein S7 (chloroplast) [Eucalyptus aromaphloia] ref|YP_008576773.1| ribosomal protein S7 (chloroplast) [Eucalyptus saligna] ref|YP_008576788.1| ribosomal protein S7 (chloroplast) [Eucalyptus saligna] ref|YP_008576858.1| ribosomal protein S7 (chloroplast) [Eucalyptus camaldulensis] ref|YP_008576873.1| ribosomal protein S7 (chloroplast) [Eucalyptus camaldulensis] ref|YP_008576943.1| ribosomal protein S7 (chloroplast) [Eucalyptus deglupta] ref|YP_008576958.1| ribosomal protein S7 (chloroplast) [Eucalyptus deglupta] ref|YP_008577028.1| ribosomal protein S7 (chloroplast) [Eucalyptus spathulata] ref|YP_008577043.1| ribosomal protein S7 (chloroplast) [Eucalyptus spathulata] ref|YP_008577113.1| ribosomal protein S7 (chloroplast) [Eucalyptus torquata] ref|YP_008577128.1| ribosomal protein S7 (chloroplast) [Eucalyptus torquata] ref|YP_008577198.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversicolor] ref|YP_008577213.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversicolor] ref|YP_008577283.1| ribosomal protein S7 (chloroplast) [Eucalyptus salmonophloia] ref|YP_008577298.1| ribosomal protein S7 (chloroplast) [Eucalyptus salmonophloia] ref|YP_008577368.1| ribosomal protein S7 (chloroplast) [Eucalyptus microcorys] ref|YP_008577383.1| ribosomal protein S7 (chloroplast) [Eucalyptus microcorys] ref|YP_008577453.1| ribosomal protein S7 (chloroplast) [Eucalyptus guilfoylei] ref|YP_008577468.1| ribosomal protein S7 (chloroplast) [Eucalyptus guilfoylei] ref|YP_008577538.1| ribosomal protein S7 (chloroplast) [Eucalyptus erythrocorys] ref|YP_008577553.1| ribosomal protein S7 (chloroplast) [Eucalyptus erythrocorys] ref|YP_008577623.1| ribosomal protein S7 (chloroplast) [Corymbia gummifera] ref|YP_008577638.1| ribosomal protein S7 (chloroplast) [Corymbia gummifera] ref|YP_008577793.1| ribosomal protein S7 (chloroplast) [Corymbia eximia] ref|YP_008577808.1| ribosomal protein S7 (chloroplast) [Corymbia eximia] ref|YP_008577878.1| ribosomal protein S7 (chloroplast) [Corymbia tessellaris] ref|YP_008577893.1| ribosomal protein S7 (chloroplast) [Corymbia tessellaris] ref|YP_008577963.1| ribosomal protein S7 (chloroplast) [Angophora floribunda] ref|YP_008577978.1| ribosomal protein S7 (chloroplast) [Angophora floribunda] ref|YP_008578048.1| ribosomal protein S7 (chloroplast) [Angophora costata] ref|YP_008578063.1| ribosomal protein S7 (chloroplast) [Angophora costata] ref|YP_008578218.1| ribosomal protein S7 (chloroplast) [Stockwellia quadrifida] ref|YP_008578233.1| ribosomal protein S7 (chloroplast) [Stockwellia quadrifida] ref|YP_008578133.1| ribosomal protein S7 (chloroplast) [Allosyncarpia ternata] ref|YP_008578148.1| ribosomal protein S7 (chloroplast) [Allosyncarpia ternata] ref|YP_008854471.1| ribosomal protein S7 [Musa textilis] ref|YP_008854484.1| ribosomal protein S7 [Musa textilis] ref|YP_008963524.1| ribosomal protein S7 (chloroplast) [Penthorum chinense] ref|YP_008963537.1| ribosomal protein S7 (chloroplast) [Penthorum chinense] ref|YP_008994335.1| ribosomal protein S7 (plastid) [Melianthus villosus] ref|YP_008994345.1| ribosomal protein S7 (plastid) [Melianthus villosus] ref|YP_009028513.1| ribosomal protein S7 (chloroplast) [Parinari campestris] ref|YP_009028526.1| ribosomal protein S7 (chloroplast) [Parinari campestris] ref|YP_009111699.1| ribosomal protein S7 (chloroplast) [Apios americana] ref|YP_009111713.1| ribosomal protein S7 (chloroplast) [Apios americana] ref|YP_009163525.1| ribosomal protein S7 (plastid) [Eugenia uniflora] ref|YP_009163538.1| ribosomal protein S7 (plastid) [Eugenia uniflora] ref|YP_009179553.1| ribosomal protein S7 (chloroplast) [Corymbia henryi] ref|YP_009179568.1| ribosomal protein S7 (chloroplast) [Corymbia henryi] ref|YP_009179638.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] ref|YP_009179652.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] ref|YP_009180417.1| ribosomal protein S7 (chloroplast) [Musa balbisiana] ref|YP_009180433.1| ribosomal protein S7 (chloroplast) [Musa balbisiana] ref|YP_009193210.1| ribosomal protein S7 (chloroplast) [Leucaena trichandra] ref|YP_009193224.1| ribosomal protein S7 (chloroplast) [Leucaena trichandra] ref|YP_009253606.1| ribosomal protein S7 (chloroplast) [Senna tora] ref|YP_009253620.1| ribosomal protein S7 (chloroplast) [Senna tora] ref|YP_009264736.1| ribosomal protein S7 (chloroplast) [Kostermanthus robustus] ref|YP_009264749.1| ribosomal protein S7 (chloroplast) [Kostermanthus robustus] ref|YP_009265979.1| ribosomal protein S7 (chloroplast) [Neocarya macrophylla] ref|YP_009265992.1| ribosomal protein S7 (chloroplast) [Neocarya macrophylla] ref|YP_009266062.1| ribosomal protein S7 (chloroplast) [Parinari capensis] ref|YP_009266075.1| ribosomal protein S7 (chloroplast) [Parinari capensis] ref|YP_009266145.1| ribosomal protein S7 (chloroplast) [Parinari curatellifolia] ref|YP_009266158.1| ribosomal protein S7 (chloroplast) [Parinari curatellifolia] ref|YP_009266228.1| ribosomal protein S7 (chloroplast) [Parinari oblongifolia] ref|YP_009266241.1| ribosomal protein S7 (chloroplast) [Parinari oblongifolia] ref|YP_009307088.1| ribosomal protein S7 (chloroplast) [Ludwigia octovalvis] ref|YP_009307100.1| ribosomal protein S7 (chloroplast) [Ludwigia octovalvis] ref|YP_009318672.1| ribosomal protein S7 (chloroplast) [Allomaieta villosa] ref|YP_009318686.1| ribosomal protein S7 (chloroplast) [Allomaieta villosa] ref|YP_009318757.1| ribosomal protein S7 (chloroplast) [Bertolonia acuminata] ref|YP_009318771.1| ribosomal protein S7 (chloroplast) [Bertolonia acuminata] ref|YP_009318842.1| ribosomal protein S7 (chloroplast) [Blakea schlimii] ref|YP_009318856.1| ribosomal protein S7 (chloroplast) [Blakea schlimii] ref|YP_009319011.1| ribosomal protein S7 (chloroplast) [Graffenrieda moritziana] ref|YP_009319025.1| ribosomal protein S7 (chloroplast) [Graffenrieda moritziana] ref|YP_009319096.1| ribosomal protein S7 (chloroplast) [Henriettea barkeri] ref|YP_009319110.1| ribosomal protein S7 (chloroplast) [Henriettea barkeri] ref|YP_009319181.1| ribosomal protein S7 (chloroplast) [Merianthera pulchra] ref|YP_009319195.1| ribosomal protein S7 (chloroplast) [Merianthera pulchra] ref|YP_009319436.1| ribosomal protein S7 (chloroplast) [Opisthocentra clidemioides] ref|YP_009319450.1| ribosomal protein S7 (chloroplast) [Opisthocentra clidemioides] ref|YP_009319520.1| ribosomal protein S7 (chloroplast) [Pterogastra divaricata] ref|YP_009319534.1| ribosomal protein S7 (chloroplast) [Pterogastra divaricata] ref|YP_009319605.1| ribosomal protein S7 (chloroplast) [Rhexia virginica] ref|YP_009319619.1| ribosomal protein S7 (chloroplast) [Rhexia virginica] ref|YP_009319858.1| ribosomal protein S7 (chloroplast) [Tibouchina longifolia] ref|YP_009319872.1| ribosomal protein S7 (chloroplast) [Tibouchina longifolia] ref|YP_009319943.1| ribosomal protein S7 (chloroplast) [Triolena amazonica] ref|YP_009319957.1| ribosomal protein S7 (chloroplast) [Triolena amazonica] ref|YP_009338882.1| ribosomal protein S7 (chloroplast) [Psidium guajava] ref|YP_009338895.1| ribosomal protein S7 (chloroplast) [Psidium guajava] ref|YP_009348398.1| ribosomal protein S7 (chloroplast) [Euphorbia esula] ref|YP_009348411.1| ribosomal protein S7 (chloroplast) [Euphorbia esula] ref|YP_009368002.1| ribosomal protein S7 (chloroplast) [Melastoma candidum] ref|YP_009368018.1| ribosomal protein S7 (chloroplast) [Melastoma candidum] ref|YP_009368412.1| ribosomal protein S7 (chloroplast) [Ammopiptanthus mongolicus] ref|YP_009368428.1| ribosomal protein S7 (chloroplast) [Ammopiptanthus mongolicus] ref|YP_009368497.1| ribosomal protein S7 (chloroplast) [Ammopiptanthus nanus] ref|YP_009368513.1| ribosomal protein S7 (chloroplast) [Ammopiptanthus nanus] ref|YP_009370942.1| ribosomal protein S7 (chloroplast) [Plinia trunciflora] ref|YP_009370955.1| ribosomal protein S7 (chloroplast) [Plinia trunciflora] ref|YP_009365372.1| ribosomal protein S7 (plastid) [Pimenta dioica] ref|YP_009365387.1| ribosomal protein S7 (plastid) [Pimenta dioica] ref|YP_009382922.1| ribosomal protein S7 (chloroplast) [Adenanthera microsperma] ref|YP_009382935.1| ribosomal protein S7 (chloroplast) [Adenanthera microsperma] ref|YP_009383272.1| ribosomal protein S7 (chloroplast) [Piptadenia communis] ref|YP_009383285.1| ribosomal protein S7 (chloroplast) [Piptadenia communis] ref|YP_009390854.1| ribosomal protein S7 (chloroplast) [Punica granatum] ref|YP_009390867.1| ribosomal protein S7 (chloroplast) [Punica granatum] ref|YP_009416905.1| ribosomal protein S7 (chloroplast) [Barthea barthei] ref|YP_009416917.1| ribosomal protein S7 (chloroplast) [Barthea barthei] ref|YP_009420618.1| ribosomal protein S7 (chloroplast) [Musa itinerans] ref|YP_009420634.1| ribosomal protein S7 (chloroplast) [Musa itinerans] ref|YP_009433660.1| ribosomal protein S7 (chloroplast) [Tigridiopalma magnifica] ref|YP_009433674.1| ribosomal protein S7 (chloroplast) [Tigridiopalma magnifica] ref|YP_009437687.1| ribosomal protein S7 (chloroplast) [Sophora alopecuroides] ref|YP_009437699.1| ribosomal protein S7 (chloroplast) [Sophora alopecuroides] ref|YP_009454019.1| ribosomal protein S7 (chloroplast) [Vachellia flava] ref|YP_009454033.1| ribosomal protein S7 (chloroplast) [Vachellia flava] ref|YP_009454101.1| ribosomal protein S7 (chloroplast) [Vachellia seyal] ref|YP_009454115.1| ribosomal protein S7 (chloroplast) [Vachellia seyal] ref|YP_009454183.1| ribosomal protein S7 (chloroplast) [Senegalia laeta] ref|YP_009454197.1| ribosomal protein S7 (chloroplast) [Senegalia laeta] ref|YP_009455538.1| ribosomal protein S7 (chloroplast) [Cercis glabra] ref|YP_009455551.1| ribosomal protein S7 (chloroplast) [Cercis glabra] ref|XP_020539073.1| uncharacterized protein LOC110010590 [Jatropha curcas] sp|Q49KT8.1|RR7_EUCGG RecName: Full=30S ribosomal protein S7, chloroplastic sp|B1NWJ5.1|RR7_MANES RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAN31997.1| ribosomal protein S7 (chloroplast) [Hydrothrix gardneri] gb|AAN32019.1| ribosomal protein S7 (chloroplast) [Xiphidium caeruleum] gb|AAX21072.1| ribosomal protein S7 (chloroplast) [Eucalyptus globulus subsp. globulus] gb|AAX21089.1| ribosomal protein S7 (chloroplast) [Eucalyptus globulus subsp. globulus] gb|ABQ14878.1| ribosomal protein S7 (chloroplast) [Myriophyllum spicatum] gb|ABQ14894.1| ribosomal protein S7 (chloroplast) [Penthorum chinense] gb|ABR23076.1| ribosomal protein S7 (plastid) [Anigozanthos flavidus] gb|ABR23084.1| ribosomal protein S7 (plastid) [Eichhornia crassipes] gb|ABU85417.1| ribosomal protein S7, partial (chloroplast) [Musa acuminata] gb|ABV66199.1| ribosomal protein S7 (chloroplast) [Manihot esculenta] gb|ABV66213.1| ribosomal protein S7 (chloroplast) [Manihot esculenta] gb|ACN72749.1| rps7 (chloroplast) [Jatropha curcas] gb|ACN72756.1| rps7 (chloroplast) [Jatropha curcas] gb|ADD29906.1| ribosomal protein S7 (chloroplast) [Gunnera manicata] gb|ADD29909.1| ribosomal protein S7 (chloroplast) [Oxalis latifolia] gb|ADH94389.1| ribosomal protein S7 (chloroplast) [Syzygium cumini] gb|ADH94402.1| ribosomal protein S7 (chloroplast) [Syzygium cumini] gb|ADO23632.1| ribosomal protein S7 (chloroplast) [Eucalyptus grandis] gb|ADO23644.1| ribosomal protein S7 (chloroplast) [Eucalyptus grandis] gb|AEK71541.1| ribosomal protein S7 (plastid) [Phyllanthus calycinus] gb|AEK71559.1| ribosomal protein S7 (plastid) [Quillaja saponaria] gb|AEK71732.1| ribosomal protein S7 (plastid) [Oxalis latifolia] gb|AEK71746.1| ribosomal protein S7 (plastid) [Gunnera manicata] gb|AEK71801.1| ribosomal protein S7 (plastid) [Erythrospermum phytolaccoides] gb|AEK71808.1| ribosomal protein S7 (plastid) [Caryocar glabrum] gb|AEK78161.1| ribosomal protein S7 (plastid) [Myrtus communis] gb|AFJ00516.1| ribosomal protein S7 (plastid) [Francoa sonchifolia] gb|AFJ00529.1| ribosomal protein S7 (plastid) [Francoa sonchifolia] gb|AFR25704.1| ribosomal protein S7 (chloroplast) [Penthorum chinense] gb|AFR25717.1| ribosomal protein S7 (chloroplast) [Penthorum chinense] gb|AGC56397.1| ribosomal protein S7 (chloroplast) [Eucalyptus obliqua] gb|AGC56412.1| ribosomal protein S7 (chloroplast) [Eucalyptus obliqua] gb|AGC56482.1| ribosomal protein S7 (chloroplast) [Eucalyptus radiata] gb|AGC56497.1| ribosomal protein S7 (chloroplast) [Eucalyptus radiata] gb|AGC56567.1| ribosomal protein S7 (chloroplast) [Eucalyptus delegatensis] gb|AGC56582.1| ribosomal protein S7 (chloroplast) [Eucalyptus delegatensis] gb|AGC56652.1| ribosomal protein S7 (chloroplast) [Eucalyptus verrucata] gb|AGC56667.1| ribosomal protein S7 (chloroplast) [Eucalyptus verrucata] gb|AGC56737.1| ribosomal protein S7 (chloroplast) [Eucalyptus baxteri] gb|AGC56752.1| ribosomal protein S7 (chloroplast) [Eucalyptus baxteri] gb|AGC56822.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversifolia] gb|AGC56837.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversifolia] gb|AGC56907.1| ribosomal protein S7 (chloroplast) [Eucalyptus sieberi] gb|AGC56922.1| ribosomal protein S7 (chloroplast) [Eucalyptus sieberi] gb|AGC56992.1| ribosomal protein S7 (chloroplast) [Eucalyptus elata] gb|AGC57007.1| ribosomal protein S7 (chloroplast) [Eucalyptus elata] gb|AGC57077.1| ribosomal protein S7 (chloroplast) [Eucalyptus regnans] gb|AGC57092.1| ribosomal protein S7 (chloroplast) [Eucalyptus regnans] gb|AGC57162.1| ribosomal protein S7 (chloroplast) [Eucalyptus umbra] gb|AGC57177.1| ribosomal protein S7 (chloroplast) [Eucalyptus umbra] gb|AGC57247.1| ribosomal protein S7 (chloroplast) [Eucalyptus cloeziana] gb|AGC57262.1| ribosomal protein S7 (chloroplast) [Eucalyptus cloeziana] gb|AGC57332.1| ribosomal protein S7 (chloroplast) [Eucalyptus patens] gb|AGC57347.1| ribosomal protein S7 (chloroplast) [Eucalyptus patens] gb|AGC57417.1| ribosomal protein S7 (chloroplast) [Eucalyptus marginata] gb|AGC57432.1| ribosomal protein S7 (chloroplast) [Eucalyptus marginata] gb|AGC57502.1| ribosomal protein S7 (chloroplast) [Eucalyptus curtisii] gb|AGC57517.1| ribosomal protein S7 (chloroplast) [Eucalyptus curtisii] gb|AGC57587.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] gb|AGC57602.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] gb|AGC57672.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] gb|AGC57687.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] gb|AGC57757.1| ribosomal protein S7 (chloroplast) [Eucalyptus polybractea] gb|AGC57772.1| ribosomal protein S7 (chloroplast) [Eucalyptus polybractea] gb|AGC57842.1| ribosomal protein S7 (chloroplast) [Eucalyptus cladocalyx] gb|AGC57857.1| ribosomal protein S7 (chloroplast) [Eucalyptus cladocalyx] gb|AGC57927.1| ribosomal protein S7 (chloroplast) [Eucalyptus globulus] gb|AGC57942.1| ribosomal protein S7 (chloroplast) [Eucalyptus globulus] gb|AGC58012.1| ribosomal protein S7 (chloroplast) [Eucalyptus nitens] gb|AGC58027.1| ribosomal protein S7 (chloroplast) [Eucalyptus nitens] gb|AGC58097.1| ribosomal protein S7 (chloroplast) [Eucalyptus aromaphloia] gb|AGC58112.1| ribosomal protein S7 (chloroplast) [Eucalyptus aromaphloia] gb|AGC58182.1| ribosomal protein S7 (chloroplast) [Eucalyptus saligna] gb|AGC58197.1| ribosomal protein S7 (chloroplast) [Eucalyptus saligna] gb|AGC58267.1| ribosomal protein S7 (chloroplast) [Eucalyptus camaldulensis] gb|AGC58282.1| ribosomal protein S7 (chloroplast) [Eucalyptus camaldulensis] gb|AGC58352.1| ribosomal protein S7 (chloroplast) [Eucalyptus deglupta] gb|AGC58367.1| ribosomal protein S7 (chloroplast) [Eucalyptus deglupta] gb|AGC58437.1| ribosomal protein S7 (chloroplast) [Eucalyptus spathulata] gb|AGC58452.1| ribosomal protein S7 (chloroplast) [Eucalyptus spathulata] gb|AGC58522.1| ribosomal protein S7 (chloroplast) [Eucalyptus torquata] gb|AGC58537.1| ribosomal protein S7 (chloroplast) [Eucalyptus torquata] gb|AGC58607.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversicolor] gb|AGC58622.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversicolor] gb|AGC58692.1| ribosomal protein S7 (chloroplast) [Eucalyptus salmonophloia] gb|AGC58707.1| ribosomal protein S7 (chloroplast) [Eucalyptus salmonophloia] gb|AGC58777.1| ribosomal protein S7 (chloroplast) [Eucalyptus microcorys] gb|AGC58792.1| ribosomal protein S7 (chloroplast) [Eucalyptus microcorys] gb|AGC58862.1| ribosomal protein S7 (chloroplast) [Eucalyptus guilfoylei] gb|AGC58877.1| ribosomal protein S7 (chloroplast) [Eucalyptus guilfoylei] gb|AGC58947.1| ribosomal protein S7 (chloroplast) [Eucalyptus erythrocorys] gb|AGC58962.1| ribosomal protein S7 (chloroplast) [Eucalyptus erythrocorys] gb|AGC59032.1| ribosomal protein S7 (chloroplast) [Corymbia gummifera] gb|AGC59047.1| ribosomal protein S7 (chloroplast) [Corymbia gummifera] gb|AGC59202.1| ribosomal protein S7 (chloroplast) [Corymbia eximia] gb|AGC59217.1| ribosomal protein S7 (chloroplast) [Corymbia eximia] gb|AGC59287.1| ribosomal protein S7 (chloroplast) [Corymbia tessellaris] gb|AGC59302.1| ribosomal protein S7 (chloroplast) [Corymbia tessellaris] gb|AGC59372.1| ribosomal protein S7 (chloroplast) [Angophora floribunda] gb|AGC59387.1| ribosomal protein S7 (chloroplast) [Angophora floribunda] gb|AGC59457.1| ribosomal protein S7 (chloroplast) [Angophora costata] gb|AGC59472.1| ribosomal protein S7 (chloroplast) [Angophora costata] gb|AGC59542.1| ribosomal protein S7 (chloroplast) [Allosyncarpia ternata] gb|AGC59557.1| ribosomal protein S7 (chloroplast) [Allosyncarpia ternata] gb|AGC59627.1| ribosomal protein S7 (chloroplast) [Stockwellia quadrifida] gb|AGC59642.1| ribosomal protein S7 (chloroplast) [Stockwellia quadrifida] gb|AGE92729.1| ribosomal protein S7 (plastid) [Heliconia collinsiana] gb|AGE92744.1| ribosomal protein S7 (plastid) [Heliconia collinsiana] gb|AGE93501.1| ribosomal protein S7 (plastid) [Xiphidium caeruleum] gb|AGE93516.1| ribosomal protein S7 (plastid) [Xiphidium caeruleum] gb|EMS51193.1| 30S ribosomal protein S7, chloroplastic [Triticum urartu] emb|CCW72423.1| rps7 (chloroplast) [Musa acuminata subsp. malaccensis] emb|CCW72442.1| rps7 (chloroplast) [Musa acuminata subsp. malaccensis] gb|AGS13053.1| ribosomal protein S7 (plastid) [Melianthus villosus] gb|AGS13065.1| ribosomal protein S7 (plastid) [Melianthus villosus] gb|AHA12560.1| ribosomal protein S7 (plastid) [Musa textilis] gb|AHA12574.1| ribosomal protein S7 (plastid) [Musa textilis] gb|AHA13056.1| ribosomal protein S7 (plastid) [Costus pulverulentus] gb|AHA13070.1| ribosomal protein S7 (plastid) [Costus pulverulentus] gb|AHI95828.1| ribosomal protein S7 (chloroplast) [Apios americana] gb|AHI95843.1| ribosomal protein S7 (chloroplast) [Apios americana] gb|AHI95911.1| ribosomal protein S7 (chloroplast) [Cercis canadensis] gb|AHI95925.1| ribosomal protein S7 (chloroplast) [Cercis canadensis] gb|AHX81233.1| ribosomal protein S7 (chloroplast) [Parinari campestris] gb|AHX81234.1| ribosomal protein S7 (chloroplast) [Parinari campestris] gb|AHY32854.1| ribosomal protein S7 (chloroplast) [Libidibia coriaria] gb|AHY32868.1| ribosomal protein S7 (chloroplast) [Libidibia coriaria] gb|AHY32937.1| ribosomal protein S7 (chloroplast) [Ceratonia siliqua] gb|AHY32951.1| ribosomal protein S7 (chloroplast) [Ceratonia siliqua] gb|AHY33020.1| ribosomal protein S7 (chloroplast) [Haematoxylum brasiletto] gb|AHY33034.1| ribosomal protein S7 (chloroplast) [Haematoxylum brasiletto] gb|AHY33351.1| ribosomal protein S7 (chloroplast) [Prosopis glandulosa] gb|AHY33365.1| ribosomal protein S7 (chloroplast) [Prosopis glandulosa] gb|KCW58507.1| hypothetical protein EUGRSUZ_H01180 [Eucalyptus grandis] gb|AJE71841.1| ribosomal protein S7 (plastid) [Amorpha canescens] gb|AJE71983.1| ribosomal protein S7 (plastid) [Baptisia bracteata] gb|AJE72054.1| ribosomal protein S7 (plastid) [Chamaecrista fasciculata] gb|AJE72409.1| ribosomal protein S7 (plastid) [Baptisia alba] gb|AJE72693.1| ribosomal protein S7 (plastid) [Amorpha fruticosa] gb|AJE72977.1| ribosomal protein S7 (plastid) [Desmanthus illinoensis] gb|AJZ71638.1| ribosomal protein S7 (chloroplast) [Corymbia citriodora subsp. variegata] gb|AJZ71653.1| ribosomal protein S7 (chloroplast) [Corymbia citriodora subsp. variegata] gb|AKC98549.1| ribosomal protein S7 (chloroplast) [Corymbia citriodora subsp. citriodora] gb|AKC98564.1| ribosomal protein S7 (chloroplast) [Corymbia citriodora subsp. citriodora] gb|AKC98634.1| ribosomal protein S7 (chloroplast) [Corymbia citriodora subsp. variegata] gb|AKC98649.1| ribosomal protein S7 (chloroplast) [Corymbia citriodora subsp. variegata] gb|AKC98719.1| ribosomal protein S7 (chloroplast) [Corymbia citriodora subsp. variegata] gb|AKC98733.1| ribosomal protein S7 (chloroplast) [Corymbia citriodora subsp. variegata] gb|AKC98803.1| ribosomal protein S7 (chloroplast) [Corymbia henryi] gb|AKC98818.1| ribosomal protein S7 (chloroplast) [Corymbia henryi] gb|AKC98888.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] gb|AKC98902.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] gb|AKC98972.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] gb|AKC98986.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] gb|AKC99056.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] gb|AKC99070.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] gb|AKC99140.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] gb|AKC99155.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] gb|AKU71522.1| ribosomal protein S7 (plastid) [Eugenia uniflora] gb|AKU71535.1| ribosomal protein S7 (plastid) [Eugenia uniflora] gb|ALF03795.1| ribosomal protein S7 (chloroplast) [Senna tora] gb|ALF03809.1| ribosomal protein S7 (chloroplast) [Senna tora] gb|ALL97085.1| ribosomal protein S7 (chloroplast) [Musa balbisiana] gb|ALL97100.1| ribosomal protein S7 (chloroplast) [Musa balbisiana] gb|ALQ11593.1| ribosomal protein S7 (chloroplast) [Leucaena trichandra] gb|ALQ11607.1| ribosomal protein S7 (chloroplast) [Leucaena trichandra] gb|AMC32658.1| ribosomal protein S7 (chloroplast) [Chamaecrista fasciculata] gb|AMC32661.1| ribosomal protein S7 (chloroplast) [Croton texensis] gb|AMC32663.1| ribosomal protein S7 (chloroplast) [Euphorbia esula] gb|AMC32670.1| ribosomal protein S7 (chloroplast) [Oxalis dillenii] gb|AMC32677.1| ribosomal protein S7 (chloroplast) [Senna marilandica] gb|ANJ19019.1| ribosomal protein S7 (chloroplast) [Kostermanthus robustus] gb|ANJ19020.1| ribosomal protein S7 (chloroplast) [Kostermanthus robustus] gb|ANJ20282.1| ribosomal protein S7 (chloroplast) [Neocarya macrophylla] gb|ANJ20297.1| ribosomal protein S7 (chloroplast) [Neocarya macrophylla] gb|ANJ20429.1| ribosomal protein S7 (chloroplast) [Parinari capensis] gb|ANJ20430.1| ribosomal protein S7 (chloroplast) [Parinari capensis] gb|ANJ20531.1| ribosomal protein S7 (chloroplast) [Parinari curatellifolia] gb|ANJ20546.1| ribosomal protein S7 (chloroplast) [Parinari curatellifolia] gb|ANJ20614.1| ribosomal protein S7 (chloroplast) [Parinari oblongifolia] gb|ANJ20629.1| ribosomal protein S7 (chloroplast) [Parinari oblongifolia] gb|ANW36992.1| ribosomal protein S7 (chloroplast) [Plinia trunciflora] gb|ANW37005.1| ribosomal protein S7 (chloroplast) [Plinia trunciflora] gb|ANY60384.1| ribosomal protein S7 (chloroplast) [Mezoneuron cucullatum] gb|ANY60385.1| ribosomal protein S7 (chloroplast) [Mezoneuron cucullatum] gb|ANZ53404.1| ribosomal protein S7 (chloroplast) [Psidium guajava] gb|ANZ53417.1| ribosomal protein S7 (chloroplast) [Psidium guajava] gb|AOR53539.1| ribosomal protein S7 (chloroplast) [Ludwigia octovalvis] gb|AOR53540.1| ribosomal protein S7 (chloroplast) [Ludwigia octovalvis] gb|APA17762.1| ribosomal protein S7 (chloroplast) [Allomaieta villosa] gb|APA17763.1| ribosomal protein S7 (chloroplast) [Allomaieta villosa] gb|APA17847.1| ribosomal protein S7 (chloroplast) [Bertolonia acuminata] gb|APA17848.1| ribosomal protein S7 (chloroplast) [Bertolonia acuminata] gb|APA17932.1| ribosomal protein S7 (chloroplast) [Blakea schlimii] gb|APA17933.1| ribosomal protein S7 (chloroplast) [Blakea schlimii] gb|APA18101.1| ribosomal protein S7 (chloroplast) [Graffenrieda moritziana] gb|APA18102.1| ribosomal protein S7 (chloroplast) [Graffenrieda moritziana] gb|APA18186.1| ribosomal protein S7 (chloroplast) [Henriettea barkeri] gb|APA18187.1| ribosomal protein S7 (chloroplast) [Henriettea barkeri] gb|APA18271.1| ribosomal protein S7 (chloroplast) [Merianthera pulchra] gb|APA18272.1| ribosomal protein S7 (chloroplast) [Merianthera pulchra] gb|APA18525.1| ribosomal protein S7 (chloroplast) [Opisthocentra clidemioides] gb|APA18526.1| ribosomal protein S7 (chloroplast) [Opisthocentra clidemioides] gb|APA18610.1| ribosomal protein S7 (chloroplast) [Pterogastra divaricata] gb|APA18611.1| ribosomal protein S7 (chloroplast) [Pterogastra divaricata] gb|APA18694.1| ribosomal protein S7 (chloroplast) [Rhexia virginica] gb|APA18695.1| ribosomal protein S7 (chloroplast) [Rhexia virginica] gb|APA18948.1| ribosomal protein S7 (chloroplast) [Tibouchina longifolia] gb|APA18949.1| ribosomal protein S7 (chloroplast) [Tibouchina longifolia] gb|APA19032.1| ribosomal protein S7 (chloroplast) [Triolena amazonica] gb|APA19033.1| ribosomal protein S7 (chloroplast) [Triolena amazonica] gb|APA32773.1| ribosomal protein S7 (chloroplast) [Adenanthera microsperma] gb|APA32786.1| ribosomal protein S7 (chloroplast) [Adenanthera microsperma] gb|APA33388.1| ribosomal protein S7 (chloroplast) [Piptadenia communis] gb|APA33401.1| ribosomal protein S7 (chloroplast) [Piptadenia communis] gb|API83280.1| ribosomal protein S7 (chloroplast) [Acca sellowiana] gb|API83293.1| ribosomal protein S7 (chloroplast) [Acca sellowiana] gb|APY18520.1| ribosomal protein S7 (chloroplast) [Euphorbia esula] gb|APY18533.1| ribosomal protein S7 (chloroplast) [Euphorbia esula] gb|ARJ60873.1| ribosomal protein S7 (plastid) [Pimenta dioica] gb|ARJ60874.1| ribosomal protein S7 (plastid) [Pimenta dioica] gb|ARK36917.1| ribosomal protein S7 (chloroplast) [Ammopiptanthus mongolicus] gb|ARK36935.1| ribosomal protein S7 (chloroplast) [Ammopiptanthus mongolicus] gb|ARK37002.1| ribosomal protein S7 (chloroplast) [Ammopiptanthus nanus] gb|ARK37020.1| ribosomal protein S7 (chloroplast) [Ammopiptanthus nanus] gb|ARM18862.1| ribosomal protein S7 (chloroplast) [Melastoma candidum] gb|ARM18878.1| ribosomal protein S7 (chloroplast) [Melastoma candidum] gb|ARV86981.1| ribosomal protein S7 (chloroplast) [Psidium guajava] gb|ARV86996.1| ribosomal protein S7 (chloroplast) [Psidium guajava] gb|ARV87317.1| ribosomal protein S7 (chloroplast) [Punica granatum] gb|ARV87331.1| ribosomal protein S7 (chloroplast) [Punica granatum] gb|ASO76306.1| ribosomal protein S7 (chloroplast) [Musa itinerans] gb|ASO76322.1| ribosomal protein S7 (chloroplast) [Musa itinerans] gb|AST09168.1| ribosomal protein S7 (chloroplast) [Barthea barthei] gb|AST09180.1| ribosomal protein S7 (chloroplast) [Barthea barthei] gb|ATD86241.1| ribosomal protein S7 (chloroplast) [Tigridiopalma magnifica] gb|ATD86255.1| ribosomal protein S7 (chloroplast) [Tigridiopalma magnifica] gb|ATE89238.1| ribosomal protein S7 (chloroplast) [Sophora alopecuroides] gb|ATE89250.1| ribosomal protein S7 (chloroplast) [Sophora alopecuroides] gb|ATG28274.1| ribosomal protein S7 (chloroplast) [Sophora alopecuroides] gb|ATG28286.1| ribosomal protein S7 (chloroplast) [Sophora alopecuroides] gb|ATL23358.1| ribosomal protein S7 (chloroplast) [Salweenia bouffordiana] gb|ATL23359.1| ribosomal protein S7 (chloroplast) [Salweenia bouffordiana] gb|ATO58841.1| ribosomal protein S7 (chloroplast) [Styphnolobium japonicum f. violaceum] gb|ATO58854.1| ribosomal protein S7 (chloroplast) [Styphnolobium japonicum f. violaceum] gb|ATO88769.1| ribosomal protein S7 (chloroplast) [Vachellia flava] gb|ATO88770.1| ribosomal protein S7 (chloroplast) [Vachellia flava] gb|ATO88851.1| ribosomal protein S7 (chloroplast) [Vachellia nilotica subsp. tomentosa] gb|ATO88852.1| ribosomal protein S7 (chloroplast) [Vachellia nilotica subsp. tomentosa] gb|ATO88933.1| ribosomal protein S7 (chloroplast) [Vachellia tortilis subsp. raddiana] gb|ATO88934.1| ribosomal protein S7 (chloroplast) [Vachellia tortilis subsp. raddiana] gb|ATO89097.1| ribosomal protein S7 (chloroplast) [Vachellia seyal] gb|ATO89098.1| ribosomal protein S7 (chloroplast) [Vachellia seyal] gb|ATO89278.1| ribosomal protein S7 (chloroplast) [Senegalia laeta] gb|ATO89292.1| ribosomal protein S7 (chloroplast) [Senegalia laeta] gb|ATO89015.1| ribosomal protein S7 (chloroplast) [Vachellia tortilis subsp. raddiana] gb|ATO89016.1| ribosomal protein S7 (chloroplast) [Vachellia tortilis subsp. raddiana] gb|AUG83534.1| ribosomal protein S7 (chloroplast) [Cercis glabra] gb|AUG83547.1| ribosomal protein S7 (chloroplast) [Cercis glabra] gb|AVE14535.1| ribosomal protein S7 (chloroplast) [Angelica tsinlingensis] gb|AVE14536.1| ribosomal protein S7 (chloroplast) [Angelica tsinlingensis] Length = 155 Score = 288 bits (736), Expect = 1e-92 Identities = 146/155 (94%), Positives = 150/155 (96%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGT E+KTAKSDPIYRNRLVNMLVNRI+K GKKSLAYQIIYRAMK+IQQKTE NPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTETNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDI VKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSEL+DA KGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009440889.1| ribosomal protein S7 (plastid) [Japonolirion osense] ref|YP_009440903.1| ribosomal protein S7 (plastid) [Japonolirion osense] gb|AAN31976.1| ribosomal protein S7 (chloroplast) [Japonolirion osense] gb|AAN31988.1| ribosomal protein S7 (chloroplast) [Cartonema philydroides] gb|AAN32003.1| ribosomal protein S7 (chloroplast) [Palisota bogneri] gb|AAN32006.1| ribosomal protein S7 (chloroplast) [Philydrum lanuginosum] gb|ABR23074.1| ribosomal protein S7 (plastid) [Tradescantia ohiensis] gb|ABR23078.1| ribosomal protein S7 (plastid) [Philydrella drummondii] gb|ABR23080.1| ribosomal protein S7 (plastid) [Helmholtzia acorifolia] gb|AEK71788.1| ribosomal protein S7 (plastid) [Tradescantia ohiensis] gb|AEZ01470.1| ribosomal protein S7 (chloroplast) [Japonolirion osense] gb|AFG25681.1| ribosomal protein S7, partial (plastid) [Belosynapsis ciliata] gb|AFG25716.1| ribosomal protein S7, partial (plastid) [Tradescantia ohiensis] gb|AHH24319.1| ribosomal protein S7 (chloroplast) [Japonolirion osense] emb|CUS18844.1| ribosomal protein S7 (plastid) [Japonolirion osense] emb|CUS18858.1| ribosomal protein S7 (plastid) [Japonolirion osense] Length = 155 Score = 288 bits (736), Expect = 1e-92 Identities = 146/155 (94%), Positives = 150/155 (96%) Frame = +1 Query: 583 MSRRGTVEKKTAKSDPIYRNRLVNMLVNRIMKDGKKSLAYQIIYRAMKRIQQKTEKNPLS 762 MSRRGT EKKTAKSDPIYRNRLVNMLVNRI+K GKKSLAYQIIYRA+K+IQQKTE NPLS Sbjct: 1 MSRRGTAEKKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 763 VLRQAIRGVTPDIVVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 942 VLRQAIRGVTPDI VKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 943 SSELLDAVKGSGDAIRKKEETHRMAEANRAFAHFR 1047 SSEL+DA KGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155