BLASTX nr result
ID: Astragalus23_contig00015856
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00015856 (623 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004512929.1| PREDICTED: putative disease resistance RPP13... 47 1e-07 ref|XP_013453007.1| hypothetical protein MTR_6g084540 [Medicago ... 43 6e-06 gb|PNX92863.1| NBS-LRR resistance protein [Trifolium pratense] >... 43 7e-06 >ref|XP_004512929.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Cicer arietinum] gb|AHB64356.1| NBS-LRR protein [Cicer arietinum] Length = 1224 Score = 47.4 bits (111), Expect(2) = 1e-07 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +3 Query: 39 LVSLTIIDLFEMESIEGSGLRHLTSLESLSFYYCKVLE 152 LVSLTI +L EM+S++G+ LRHL+SLESL F +C LE Sbjct: 1136 LVSLTISNLSEMKSLKGNVLRHLSSLESLHFLHCPRLE 1173 Score = 36.6 bits (83), Expect(2) = 1e-07 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 152 TALC*KQGGYGSERGEHWSNIAHIPVIE 235 T C + Y ++RG+HW NI+HIPVI+ Sbjct: 1190 TKCCLLEARYENQRGKHWCNISHIPVIK 1217 >ref|XP_013453007.1| hypothetical protein MTR_6g084540 [Medicago truncatula] gb|KEH27035.1| hypothetical protein MTR_6g084540 [Medicago truncatula] Length = 232 Score = 43.1 bits (100), Expect(2) = 6e-06 Identities = 21/38 (55%), Positives = 29/38 (76%) Frame = +3 Query: 39 LVSLTIIDLFEMESIEGSGLRHLTSLESLSFYYCKVLE 152 LVSLTI +L EM+S +G+ +HL+SLESL F +C +E Sbjct: 144 LVSLTITNLSEMKSFKGNVFQHLSSLESLHFLHCPGIE 181 Score = 35.0 bits (79), Expect(2) = 6e-06 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = +2 Query: 179 YGSERGEHWSNIAHIPVIE 235 Y +G+HWSNIAHIPVI+ Sbjct: 207 YEDHKGKHWSNIAHIPVIK 225 >gb|PNX92863.1| NBS-LRR resistance protein [Trifolium pratense] gb|PNY16530.1| NBS-LRR resistance protein [Trifolium pratense] Length = 1222 Score = 42.7 bits (99), Expect(2) = 7e-06 Identities = 21/38 (55%), Positives = 29/38 (76%) Frame = +3 Query: 39 LVSLTIIDLFEMESIEGSGLRHLTSLESLSFYYCKVLE 152 LVSLTI +L EM+S++ + +HL+SLESL F +C LE Sbjct: 1134 LVSLTITNLTEMKSLKENAFQHLSSLESLHFLHCPGLE 1171 Score = 35.0 bits (79), Expect(2) = 7e-06 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 179 YGSERGEHWSNIAHIPVIE 235 Y S+RG+ WSNIAHIPVI+ Sbjct: 1197 YESQRGKDWSNIAHIPVIK 1215