BLASTX nr result
ID: Astragalus23_contig00015517
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00015517 (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019448104.1| PREDICTED: uncharacterized protein LOC109351... 58 2e-08 >ref|XP_019448104.1| PREDICTED: uncharacterized protein LOC109351185 [Lupinus angustifolius] Length = 77 Score = 57.8 bits (138), Expect = 2e-08 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +3 Query: 330 VIVITMSIRITARTHHFKLKILCTHWTFVR 419 V+V+TMSIR+TAR++HFKLKILC HWTF+R Sbjct: 4 VVVVTMSIRVTARSYHFKLKILCAHWTFMR 33