BLASTX nr result
ID: Astragalus23_contig00015284
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00015284 (457 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH20868.1| hypothetical protein GLYMA_13G205600 [Glycine max] 55 5e-06 >gb|KRH20868.1| hypothetical protein GLYMA_13G205600 [Glycine max] Length = 367 Score = 55.5 bits (132), Expect = 5e-06 Identities = 37/58 (63%), Positives = 41/58 (70%), Gaps = 5/58 (8%) Frame = -1 Query: 457 RIQTSGMAV----ADIMD-IPKVMKIMVMQQLLLDRTPMCMAVIRGMQVTNLLSNSSK 299 +IQTSGM V D M + KVMKIM M LLLDR P CMAVIRG+ VTN LSNS+K Sbjct: 311 QIQTSGMVVLVLVVDTMGMLHKVMKIMGML-LLLDRIPTCMAVIRGILVTNHLSNSNK 367