BLASTX nr result
ID: Astragalus23_contig00015153
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00015153 (583 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004510318.1| PREDICTED: nuclear poly(A) polymerase 4-like... 64 3e-08 >ref|XP_004510318.1| PREDICTED: nuclear poly(A) polymerase 4-like [Cicer arietinum] Length = 722 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 480 MGSSEGLGASLKASSQVPPKQYGVTKPISMAGPT 581 MGSSEGLGAS K S+Q PPKQYGVTKPISMAGPT Sbjct: 1 MGSSEGLGASSKPSTQAPPKQYGVTKPISMAGPT 34