BLASTX nr result
ID: Astragalus23_contig00014862
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00014862 (778 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013441723.1| sucrose synthase [Medicago truncatula] >gi|6... 63 1e-07 >ref|XP_013441723.1| sucrose synthase [Medicago truncatula] gb|KEH15748.1| sucrose synthase [Medicago truncatula] Length = 759 Score = 63.2 bits (152), Expect = 1e-07 Identities = 33/72 (45%), Positives = 38/72 (52%), Gaps = 2/72 (2%) Frame = -2 Query: 387 WDPGEHFQMSKVLWSFQFKQWDPGGYSLVHGQCSLDLGSICQYVTIT--HQYYLAFNLED 214 W+PGE + + S FKQWDPGG SL+ GQ D + T T YY FNLED Sbjct: 658 WEPGEQLEPHMTVQSSPFKQWDPGGCSLICGQGLCDFSGYLKVTTTTTIQHYYFGFNLED 717 Query: 213 KAGFKRKCIVMS 178 K FK VMS Sbjct: 718 KVDFKGDGNVMS 729