BLASTX nr result
ID: Astragalus23_contig00014511
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00014511 (1232 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003590171.1| transmembrane protein, putative [Medicago tr... 67 3e-09 >ref|XP_003590171.1| transmembrane protein, putative [Medicago truncatula] gb|AES60422.1| transmembrane protein, putative [Medicago truncatula] Length = 209 Score = 67.4 bits (163), Expect = 3e-09 Identities = 45/139 (32%), Positives = 67/139 (48%), Gaps = 22/139 (15%) Frame = -2 Query: 814 YCSQALFLSTDVSSLYVLFCVCWLGFNCVK------------CAFRVFVEKPMYLWVLWI 671 YC +D S + V+F +L F+CV A ++FV+ P + W W Sbjct: 67 YCRLVSSTGSDFSFIVVMFDCIFLCFSCVMFFYFCSCLCFVMVAQKLFVKMPQWCWTFWT 126 Query: 670 VLLCSSFSI-------FSALLMDPTHVMILANIDTIYNHKVLVAVKEIILNWIEPKT-DG 515 ++C+ + FS MD V+ L N +T Y+ VL VKE+ILNWI+ KT D Sbjct: 127 RVMCAYLKVAANNLYLFSTKQMDSKFVVSLTNFETTYSRYVLAKVKEMILNWIDKKTVDL 186 Query: 514 PLAIV--PVWMILVWLLGF 464 + V + LVW++GF Sbjct: 187 LFSFVNDHLRKKLVWVIGF 205