BLASTX nr result
ID: Astragalus23_contig00014499
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00014499 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004506775.1| PREDICTED: uncharacterized protein LOC101489... 60 9e-08 dbj|GAU13966.1| hypothetical protein TSUD_262930 [Trifolium subt... 55 3e-06 >ref|XP_004506775.1| PREDICTED: uncharacterized protein LOC101489545 isoform X3 [Cicer arietinum] Length = 472 Score = 59.7 bits (143), Expect = 9e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 392 LAPAMEDGSNSEPIYGNALQNDINWGRETV 303 LAP ME+GSNS PI+GNALQNDINWGRETV Sbjct: 433 LAPTMEEGSNSHPIHGNALQNDINWGRETV 462 >dbj|GAU13966.1| hypothetical protein TSUD_262930 [Trifolium subterraneum] Length = 412 Score = 55.5 bits (132), Expect = 3e-06 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 389 APAMEDGSNSEPIYGNALQNDINWGRETV 303 AP++E+GSNSEPI+GNAL+NDI+WGRETV Sbjct: 374 APSIEEGSNSEPIHGNALRNDIDWGRETV 402