BLASTX nr result
ID: Astragalus23_contig00014480
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00014480 (514 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU44603.1| hypothetical protein TSUD_240950 [Trifolium subt... 54 2e-06 >dbj|GAU44603.1| hypothetical protein TSUD_240950 [Trifolium subterraneum] Length = 83 Score = 53.5 bits (127), Expect = 2e-06 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = +3 Query: 366 EMNFKLVLQNHEDDFLLVITFECQNCYVVAMFHRKMIDRGR 488 E+NFK LQ ED F+ +I FECQ +VVA+ HRKMI RG+ Sbjct: 40 ELNFKCALQYQEDGFISMIMFECQEYFVVAVLHRKMIPRGQ 80