BLASTX nr result
ID: Astragalus23_contig00014455
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00014455 (341 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU42963.1| hypothetical protein TSUD_143000 [Trifolium subt... 60 1e-08 >dbj|GAU42963.1| hypothetical protein TSUD_143000 [Trifolium subterraneum] Length = 174 Score = 59.7 bits (143), Expect = 1e-08 Identities = 34/67 (50%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Frame = +3 Query: 75 ILFALPPPEPPDKAGISTSLLVLTY-PWDPGPFDSPPLTTVSGTHYFFQLEREGLIGTPS 251 I ALP EPPD+ + TS L Y P+DPGP ++P LT V TH FQ E EGL TP Sbjct: 107 IPIALPSLEPPDRVVLPTSPLSAPYYPYDPGPINAPSLTNVCYTHNSFQYEHEGLTRTPF 166 Query: 252 QSVKEID 272 K ID Sbjct: 167 LYDKAID 173