BLASTX nr result
ID: Astragalus23_contig00014097
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00014097 (303 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH57950.1| hypothetical protein GLYMA_05G095400 [Glycine max] 61 4e-10 ref|XP_010067559.1| PREDICTED: ferritin-3, chloroplastic [Eucaly... 64 5e-10 gb|PNX83918.1| ferritin-1, partial [Trifolium pratense] >gi|1335... 61 9e-10 gb|PNY13339.1| ferritin-2 [Trifolium pratense] 63 2e-09 ref|XP_022745770.1| ferritin-3, chloroplastic-like [Durio zibeth... 62 3e-09 ref|XP_008811159.1| PREDICTED: ferritin-3, chloroplastic-like [P... 62 3e-09 dbj|BAH95031.1| Os11g0106700, partial [Oryza sativa Japonica Group] 58 4e-09 ref|XP_020252826.1| ferritin-4, chloroplastic-like [Asparagus of... 62 4e-09 gb|EAZ17152.1| hypothetical protein OsJ_32658 [Oryza sativa Japo... 58 5e-09 ref|XP_011469943.1| PREDICTED: ferritin-4, chloroplastic [Fragar... 62 5e-09 ref|XP_020226431.1| ferritin-3, chloroplastic [Cajanus cajan] 61 6e-09 gb|KYP56480.1| hypothetical protein KK1_002721 [Cajanus cajan] 61 6e-09 gb|KRG97687.1| hypothetical protein GLYMA_18G024600 [Glycine max] 61 6e-09 ref|NP_001241944.1| ferritin-3, chloroplastic-like [Glycine max]... 61 6e-09 dbj|GAU18132.1| hypothetical protein TSUD_248330 [Trifolium subt... 61 6e-09 ref|NP_001237032.1| ferritin-3, chloroplastic [Glycine max] >gi|... 61 6e-09 gb|AFO70135.1| ferritin Fer11;1 [Glycine max] 61 6e-09 ref|XP_021732536.1| ferritin-3, chloroplastic-like [Chenopodium ... 61 7e-09 ref|XP_021769243.1| ferritin-3, chloroplastic-like [Chenopodium ... 61 7e-09 ref|XP_018821858.1| PREDICTED: ferritin-3, chloroplastic [Juglan... 61 7e-09 >gb|KRH57950.1| hypothetical protein GLYMA_05G095400 [Glycine max] Length = 89 Score = 61.2 bits (147), Expect = 4e-10 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYVAQLRRVGKGHGVWHFDQ LLHEE A Sbjct: 54 SEYVAQLRRVGKGHGVWHFDQMLLHEEGVA 83 >ref|XP_010067559.1| PREDICTED: ferritin-3, chloroplastic [Eucalyptus grandis] gb|KCW65711.1| hypothetical protein EUGRSUZ_G03088 [Eucalyptus grandis] gb|KCW65712.1| hypothetical protein EUGRSUZ_G03088 [Eucalyptus grandis] Length = 266 Score = 64.3 bits (155), Expect = 5e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYVAQLRRVGKGHGVWHFDQ LLHEEAAA Sbjct: 237 SEYVAQLRRVGKGHGVWHFDQMLLHEEAAA 266 >gb|PNX83918.1| ferritin-1, partial [Trifolium pratense] gb|PNX84147.1| ferritin-1, partial [Trifolium pratense] Length = 109 Score = 60.8 bits (146), Expect = 9e-10 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYV+QLRRVGKGHGVWHFDQ LLHEE AA Sbjct: 80 SEYVSQLRRVGKGHGVWHFDQRLLHEEHAA 109 >gb|PNY13339.1| ferritin-2 [Trifolium pratense] Length = 255 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYVAQLRRVGKGHGVWHFDQTLL EEAAA Sbjct: 225 SEYVAQLRRVGKGHGVWHFDQTLLAEEAAA 254 >ref|XP_022745770.1| ferritin-3, chloroplastic-like [Durio zibethinus] Length = 270 Score = 62.4 bits (150), Expect = 3e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYVAQLRRVGKGHGVWHFDQ LLHEEA A Sbjct: 239 SEYVAQLRRVGKGHGVWHFDQMLLHEEAEA 268 >ref|XP_008811159.1| PREDICTED: ferritin-3, chloroplastic-like [Phoenix dactylifera] Length = 261 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYVAQLRRVGKGHGVWHFDQ LLHEE AA Sbjct: 231 SEYVAQLRRVGKGHGVWHFDQMLLHEEDAA 260 >dbj|BAH95031.1| Os11g0106700, partial [Oryza sativa Japonica Group] Length = 69 Score = 58.2 bits (139), Expect = 4e-09 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEA 84 SEYVAQLRRVGKGHGVWHFDQ LL EEA Sbjct: 42 SEYVAQLRRVGKGHGVWHFDQKLLEEEA 69 >ref|XP_020252826.1| ferritin-4, chloroplastic-like [Asparagus officinalis] Length = 255 Score = 61.6 bits (148), Expect = 4e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYVAQLRRVGKGHGVWHFDQ LLHE AAA Sbjct: 226 SEYVAQLRRVGKGHGVWHFDQMLLHEGAAA 255 >gb|EAZ17152.1| hypothetical protein OsJ_32658 [Oryza sativa Japonica Group] Length = 77 Score = 58.2 bits (139), Expect = 5e-09 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEA 84 SEYVAQLRRVGKGHGVWHFDQ LL EEA Sbjct: 50 SEYVAQLRRVGKGHGVWHFDQKLLEEEA 77 >ref|XP_011469943.1| PREDICTED: ferritin-4, chloroplastic [Fragaria vesca subsp. vesca] Length = 273 Score = 61.6 bits (148), Expect = 5e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYVAQLRRVGKGHGVWHFDQ LLH+E AA Sbjct: 244 SEYVAQLRRVGKGHGVWHFDQMLLHDEVAA 273 >ref|XP_020226431.1| ferritin-3, chloroplastic [Cajanus cajan] Length = 244 Score = 61.2 bits (147), Expect = 6e-09 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYVAQLRRVGKGHGVWHFDQ LLHEE A Sbjct: 214 SEYVAQLRRVGKGHGVWHFDQMLLHEEGVA 243 >gb|KYP56480.1| hypothetical protein KK1_002721 [Cajanus cajan] Length = 248 Score = 61.2 bits (147), Expect = 6e-09 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYVAQLRRVGKGHGVWHFDQ LLHEE A Sbjct: 218 SEYVAQLRRVGKGHGVWHFDQMLLHEEGVA 247 >gb|KRG97687.1| hypothetical protein GLYMA_18G024600 [Glycine max] Length = 248 Score = 61.2 bits (147), Expect = 6e-09 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYVAQLRRVGKGHGVWHFDQ LLHEE A Sbjct: 218 SEYVAQLRRVGKGHGVWHFDQMLLHEEGVA 247 >ref|NP_001241944.1| ferritin-3, chloroplastic-like [Glycine max] gb|ACU23985.1| unknown [Glycine max] Length = 248 Score = 61.2 bits (147), Expect = 6e-09 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYVAQLRRVGKGHGVWHFDQ LLHEE A Sbjct: 218 SEYVAQLRRVGKGHGVWHFDQMLLHEEGVA 247 >dbj|GAU18132.1| hypothetical protein TSUD_248330 [Trifolium subterraneum] Length = 255 Score = 61.2 bits (147), Expect = 6e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYVAQLRRVGKGHGVWHFDQ LL EEAAA Sbjct: 225 SEYVAQLRRVGKGHGVWHFDQMLLEEEAAA 254 >ref|NP_001237032.1| ferritin-3, chloroplastic [Glycine max] sp|Q948P6.1|FRI3_SOYBN RecName: Full=Ferritin-3, chloroplastic; AltName: Full=SFerH-3; Flags: Precursor dbj|BAB64536.1| ferritin [Glycine max] gb|KHN04783.1| Ferritin-3, chloroplastic [Glycine soja] gb|KRH31181.1| hypothetical protein GLYMA_11G232600 [Glycine max] Length = 256 Score = 61.2 bits (147), Expect = 6e-09 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYVAQLRRVGKGHGVWHFDQ LLHEE A Sbjct: 226 SEYVAQLRRVGKGHGVWHFDQMLLHEEGVA 255 >gb|AFO70135.1| ferritin Fer11;1 [Glycine max] Length = 256 Score = 61.2 bits (147), Expect = 6e-09 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYVAQLRRVGKGHGVWHFDQ LLHEE A Sbjct: 226 SEYVAQLRRVGKGHGVWHFDQMLLHEEGVA 255 >ref|XP_021732536.1| ferritin-3, chloroplastic-like [Chenopodium quinoa] Length = 268 Score = 61.2 bits (147), Expect = 7e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYVAQLRR+GKGHGVWHFDQTLLHE AA Sbjct: 237 SEYVAQLRRIGKGHGVWHFDQTLLHEGDAA 266 >ref|XP_021769243.1| ferritin-3, chloroplastic-like [Chenopodium quinoa] Length = 268 Score = 61.2 bits (147), Expect = 7e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 90 SEYVAQLRR+GKGHGVWHFDQTLLHE AA Sbjct: 237 SEYVAQLRRIGKGHGVWHFDQTLLHEGDAA 266 >ref|XP_018821858.1| PREDICTED: ferritin-3, chloroplastic [Juglans regia] Length = 278 Score = 61.2 bits (147), Expect = 7e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 1 SEYVAQLRRVGKGHGVWHFDQTLLHEEAA 87 SEYVAQLRRVGKGHGVWHFDQ LLHEE A Sbjct: 245 SEYVAQLRRVGKGHGVWHFDQMLLHEEGA 273