BLASTX nr result
ID: Astragalus23_contig00012322
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00012322 (446 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015888537.1| PREDICTED: uncharacterized protein LOC107423... 59 3e-07 gb|PNX82627.1| putative WD-repeat-like protein, partial [Trifoli... 56 9e-07 ref|XP_019414902.1| PREDICTED: uncharacterized protein LOC109326... 57 2e-06 gb|PNX71800.1| U5 small nuclear ribonucleoprotein 40 kDa-like pr... 56 2e-06 gb|PNX98330.1| putative WD-repeat-like protein, partial [Trifoli... 56 2e-06 ref|XP_011042993.1| PREDICTED: uncharacterized protein LOC105138... 56 3e-06 ref|XP_002318174.2| hypothetical protein POPTR_0012s10990g [Popu... 56 3e-06 ref|XP_011042992.1| PREDICTED: uncharacterized protein LOC105138... 56 3e-06 gb|PNT01524.1| hypothetical protein POPTR_015G106300v3 [Populus ... 56 3e-06 ref|XP_002321752.2| transducin family protein [Populus trichocarpa] 56 3e-06 ref|XP_002318173.2| transducin family protein [Populus trichocar... 56 3e-06 gb|PNT01523.1| hypothetical protein POPTR_015G106300v3 [Populus ... 56 3e-06 ref|XP_006374573.1| hypothetical protein POPTR_0015s11760g [Popu... 56 3e-06 ref|XP_011040276.1| PREDICTED: uncharacterized protein LOC105136... 56 3e-06 gb|PNT10546.1| hypothetical protein POPTR_012G108100v3 [Populus ... 56 3e-06 ref|XP_011042991.1| PREDICTED: uncharacterized protein LOC105138... 56 3e-06 gb|OMO94736.1| hypothetical protein CCACVL1_05854 [Corchorus cap... 56 4e-06 gb|KDO51256.1| hypothetical protein CISIN_1g009203mg [Citrus sin... 56 4e-06 ref|XP_006485089.1| PREDICTED: U5 small nuclear ribonucleoprotei... 56 4e-06 ref|XP_006436960.1| U5 small nuclear ribonucleoprotein 40 kDa pr... 56 4e-06 >ref|XP_015888537.1| PREDICTED: uncharacterized protein LOC107423487 [Ziziphus jujuba] Length = 521 Score = 58.9 bits (141), Expect = 3e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGADR+I GF V+VGRADFKHQI S Sbjct: 362 GMQQKQIVLSAGADRRIIGFDVNVGRADFKHQIES 396 >gb|PNX82627.1| putative WD-repeat-like protein, partial [Trifolium pratense] gb|PNX84457.1| putative WD-repeat-like protein, partial [Trifolium pratense] Length = 192 Score = 56.2 bits (134), Expect = 9e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGADR+I GF V VGRADF HQI S Sbjct: 138 GMQQKQIVLSAGADRRIFGFDVGVGRADFSHQIDS 172 >ref|XP_019414902.1| PREDICTED: uncharacterized protein LOC109326642 [Lupinus angustifolius] gb|OIV98156.1| hypothetical protein TanjilG_12192 [Lupinus angustifolius] Length = 525 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGAD++I GF V VGRADFKHQI S Sbjct: 366 GMQQKQIVLSAGADKRIFGFDVHVGRADFKHQIDS 400 >gb|PNX71800.1| U5 small nuclear ribonucleoprotein 40 kDa-like protein, partial [Trifolium pratense] Length = 298 Score = 56.2 bits (134), Expect = 2e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGADR+I GF V VGRADF HQI S Sbjct: 138 GMQQKQIVLSAGADRRIFGFDVGVGRADFSHQIDS 172 >gb|PNX98330.1| putative WD-repeat-like protein, partial [Trifolium pratense] Length = 392 Score = 56.2 bits (134), Expect = 2e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGADR+I GF V VGRADF HQI S Sbjct: 338 GMQQKQIVLSAGADRRIFGFDVGVGRADFSHQIDS 372 >ref|XP_011042993.1| PREDICTED: uncharacterized protein LOC105138568 isoform X3 [Populus euphratica] Length = 468 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGAD++I GF V VGRADFKHQ+ S Sbjct: 309 GMQQKQIVLSAGADKRIVGFDVQVGRADFKHQLDS 343 >ref|XP_002318174.2| hypothetical protein POPTR_0012s10990g [Populus trichocarpa] gb|ABK95770.1| unknown [Populus trichocarpa] gb|PNT10548.1| hypothetical protein POPTR_012G108100v3 [Populus trichocarpa] Length = 468 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGAD++I GF V VGRADFKHQ+ S Sbjct: 309 GMQQKQIVLSAGADKRIVGFDVQVGRADFKHQLDS 343 >ref|XP_011042992.1| PREDICTED: uncharacterized protein LOC105138568 isoform X2 [Populus euphratica] Length = 489 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGAD++I GF V VGRADFKHQ+ S Sbjct: 424 GMQQKQIVLSAGADKRIVGFDVQVGRADFKHQLDS 458 >gb|PNT01524.1| hypothetical protein POPTR_015G106300v3 [Populus trichocarpa] Length = 527 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGAD++I GF V VGRADFKHQ+ S Sbjct: 368 GMQQKQIVLSAGADKRIVGFDVQVGRADFKHQLDS 402 >ref|XP_002321752.2| transducin family protein [Populus trichocarpa] Length = 527 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGAD++I GF V VGRADFKHQ+ S Sbjct: 368 GMQQKQIVLSAGADKRIVGFDVQVGRADFKHQLDS 402 >ref|XP_002318173.2| transducin family protein [Populus trichocarpa] gb|PNT10547.1| hypothetical protein POPTR_012G108100v3 [Populus trichocarpa] Length = 530 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGAD++I GF V VGRADFKHQ+ S Sbjct: 371 GMQQKQIVLSAGADKRIVGFDVQVGRADFKHQLDS 405 >gb|PNT01523.1| hypothetical protein POPTR_015G106300v3 [Populus trichocarpa] Length = 577 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGAD++I GF V VGRADFKHQ+ S Sbjct: 418 GMQQKQIVLSAGADKRIVGFDVQVGRADFKHQLDS 452 >ref|XP_006374573.1| hypothetical protein POPTR_0015s11760g [Populus trichocarpa] Length = 577 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGAD++I GF V VGRADFKHQ+ S Sbjct: 418 GMQQKQIVLSAGADKRIVGFDVQVGRADFKHQLDS 452 >ref|XP_011040276.1| PREDICTED: uncharacterized protein LOC105136573 [Populus euphratica] Length = 578 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGAD++I GF V VGRADFKHQ+ S Sbjct: 419 GMQQKQIVLSAGADKRIVGFDVQVGRADFKHQLDS 453 >gb|PNT10546.1| hypothetical protein POPTR_012G108100v3 [Populus trichocarpa] Length = 582 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGAD++I GF V VGRADFKHQ+ S Sbjct: 423 GMQQKQIVLSAGADKRIVGFDVQVGRADFKHQLDS 457 >ref|XP_011042991.1| PREDICTED: uncharacterized protein LOC105138568 isoform X1 [Populus euphratica] Length = 583 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGAD++I GF V VGRADFKHQ+ S Sbjct: 424 GMQQKQIVLSAGADKRIVGFDVQVGRADFKHQLDS 458 >gb|OMO94736.1| hypothetical protein CCACVL1_05854 [Corchorus capsularis] Length = 529 Score = 55.8 bits (133), Expect = 4e-06 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVSLHSSASITATP 140 GMQ+KQ+VLSAGAD++I GF V VGRAD+KHQI S S+ A P Sbjct: 371 GMQQKQVVLSAGADKRIIGFDVHVGRADYKHQIDS--KCMSVLANP 414 >gb|KDO51256.1| hypothetical protein CISIN_1g009203mg [Citrus sinensis] Length = 540 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGAD++I GF VGRADFKHQI S Sbjct: 382 GMQQKQIVLSAGADKRIIGFDAGVGRADFKHQIES 416 >ref|XP_006485089.1| PREDICTED: U5 small nuclear ribonucleoprotein 40 kDa protein [Citrus sinensis] dbj|GAY51591.1| hypothetical protein CUMW_135350 [Citrus unshiu] Length = 540 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGAD++I GF VGRADFKHQI S Sbjct: 382 GMQQKQIVLSAGADKRIIGFDAGVGRADFKHQIES 416 >ref|XP_006436960.1| U5 small nuclear ribonucleoprotein 40 kDa protein [Citrus clementina] gb|ESR50200.1| hypothetical protein CICLE_v10031176mg [Citrus clementina] Length = 540 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 3 GMQKKQIVLSAGADRKI*GFGVSVGRADFKHQIVS 107 GMQ+KQIVLSAGAD++I GF VGRADFKHQI S Sbjct: 382 GMQQKQIVLSAGADKRIIGFDAGVGRADFKHQIES 416