BLASTX nr result
ID: Astragalus23_contig00011713
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00011713 (400 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU44918.1| hypothetical protein TSUD_25810 [Trifolium subte... 62 2e-08 ref|XP_012570330.1| PREDICTED: RNA polymerase sigma factor sigF,... 61 4e-08 ref|XP_003590454.2| RNA polymerase sigma factor [Medicago trunca... 61 4e-08 ref|XP_004497527.1| PREDICTED: RNA polymerase sigma factor sigF,... 61 4e-08 gb|PNY07884.1| RNA polymerase sigma factor sigF chloroplastic-li... 58 4e-07 dbj|GAV75806.1| Sigma70_r3 domain-containing protein/Sigma70_r2 ... 58 5e-07 gb|PON60336.1| RNA polymerase sigma factor [Parasponia andersonii] 58 5e-07 gb|KJB36542.1| hypothetical protein B456_006G165200 [Gossypium r... 57 9e-07 ref|XP_017603241.1| PREDICTED: RNA polymerase sigma factor sigF,... 57 9e-07 ref|XP_012485939.1| PREDICTED: RNA polymerase sigma factor sigF,... 57 9e-07 gb|KJB36540.1| hypothetical protein B456_006G165200 [Gossypium r... 57 9e-07 ref|XP_017603238.1| PREDICTED: RNA polymerase sigma factor sigF,... 57 9e-07 ref|XP_016723150.1| PREDICTED: RNA polymerase sigma factor sigF,... 57 9e-07 ref|XP_012485938.1| PREDICTED: RNA polymerase sigma factor sigF,... 57 9e-07 gb|PPS11919.1| hypothetical protein GOBAR_AA08740 [Gossypium bar... 57 9e-07 gb|PPD67093.1| hypothetical protein GOBAR_DD36029 [Gossypium bar... 57 9e-07 ref|XP_017603237.1| PREDICTED: RNA polymerase sigma factor sigF,... 57 9e-07 ref|XP_016723149.1| PREDICTED: RNA polymerase sigma factor sigF,... 57 9e-07 ref|XP_012485937.1| PREDICTED: RNA polymerase sigma factor sigF,... 57 9e-07 gb|KHG01807.1| RNA polymerase sigma factor rpoD [Gossypium arbor... 57 9e-07 >dbj|GAU44918.1| hypothetical protein TSUD_25810 [Trifolium subterraneum] Length = 528 Score = 61.6 bits (148), Expect = 2e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FG+SRERVRQLENRALYKIKK LV+QGL+AYA +LI Sbjct: 493 FGMSRERVRQLENRALYKIKKCLVNQGLDAYAEMLI 528 >ref|XP_012570330.1| PREDICTED: RNA polymerase sigma factor sigF, chloroplastic-like isoform X2 [Cicer arietinum] Length = 543 Score = 60.8 bits (146), Expect = 4e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLSRERVRQLE+RALYK+KK LV QGL+AYA+LLI Sbjct: 508 FGLSRERVRQLESRALYKLKKSLVCQGLDAYADLLI 543 >ref|XP_003590454.2| RNA polymerase sigma factor [Medicago truncatula] gb|AES60705.2| RNA polymerase sigma factor [Medicago truncatula] Length = 561 Score = 60.8 bits (146), Expect = 4e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLSRERVRQLE+RALYK+KK LV QGL+AYA+LLI Sbjct: 526 FGLSRERVRQLESRALYKLKKYLVGQGLDAYADLLI 561 >ref|XP_004497527.1| PREDICTED: RNA polymerase sigma factor sigF, chloroplastic-like isoform X1 [Cicer arietinum] Length = 576 Score = 60.8 bits (146), Expect = 4e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLSRERVRQLE+RALYK+KK LV QGL+AYA+LLI Sbjct: 541 FGLSRERVRQLESRALYKLKKSLVCQGLDAYADLLI 576 >gb|PNY07884.1| RNA polymerase sigma factor sigF chloroplastic-like [Trifolium pratense] Length = 503 Score = 58.2 bits (139), Expect = 4e-07 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLSRER+ QLENRALY++KK LVSQGL+AYA+ LI Sbjct: 468 FGLSRERIHQLENRALYRLKKCLVSQGLDAYADKLI 503 >dbj|GAV75806.1| Sigma70_r3 domain-containing protein/Sigma70_r2 domain-containing protein/Sigma70_r4 domain-containing protein [Cephalotus follicularis] Length = 564 Score = 57.8 bits (138), Expect = 5e-07 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLS+ERVRQLENRA+YK+K+ L +QGL+AYANL+I Sbjct: 529 FGLSKERVRQLENRAIYKLKQCLDNQGLDAYANLII 564 >gb|PON60336.1| RNA polymerase sigma factor [Parasponia andersonii] Length = 565 Score = 57.8 bits (138), Expect = 5e-07 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLS+ERVRQLE+RALYK+K+ LVSQ L AYANLL+ Sbjct: 530 FGLSKERVRQLESRALYKLKQCLVSQDLGAYANLLV 565 >gb|KJB36542.1| hypothetical protein B456_006G165200 [Gossypium raimondii] Length = 454 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLS+ERVRQLE+RALYK+K+ LV QGL AYA+LL+ Sbjct: 419 FGLSKERVRQLESRALYKLKQCLVKQGLGAYADLLV 454 >ref|XP_017603241.1| PREDICTED: RNA polymerase sigma factor sigF, chloroplastic-like isoform X3 [Gossypium arboreum] Length = 482 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLS+ERVRQLE+RALYK+K+ LV QGL AYA+LL+ Sbjct: 447 FGLSKERVRQLESRALYKLKQCLVKQGLGAYADLLV 482 >ref|XP_012485939.1| PREDICTED: RNA polymerase sigma factor sigF, chloroplastic-like isoform X3 [Gossypium raimondii] Length = 482 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLS+ERVRQLE+RALYK+K+ LV QGL AYA+LL+ Sbjct: 447 FGLSKERVRQLESRALYKLKQCLVKQGLGAYADLLV 482 >gb|KJB36540.1| hypothetical protein B456_006G165200 [Gossypium raimondii] Length = 507 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLS+ERVRQLE+RALYK+K+ LV QGL AYA+LL+ Sbjct: 472 FGLSKERVRQLESRALYKLKQCLVKQGLGAYADLLV 507 >ref|XP_017603238.1| PREDICTED: RNA polymerase sigma factor sigF, chloroplastic-like isoform X2 [Gossypium arboreum] Length = 562 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLS+ERVRQLE+RALYK+K+ LV QGL AYA+LL+ Sbjct: 527 FGLSKERVRQLESRALYKLKQCLVKQGLGAYADLLV 562 >ref|XP_016723150.1| PREDICTED: RNA polymerase sigma factor sigF, chloroplastic-like isoform X2 [Gossypium hirsutum] Length = 562 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLS+ERVRQLE+RALYK+K+ LV QGL AYA+LL+ Sbjct: 527 FGLSKERVRQLESRALYKLKQCLVKQGLGAYADLLV 562 >ref|XP_012485938.1| PREDICTED: RNA polymerase sigma factor sigF, chloroplastic-like isoform X2 [Gossypium raimondii] Length = 562 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLS+ERVRQLE+RALYK+K+ LV QGL AYA+LL+ Sbjct: 527 FGLSKERVRQLESRALYKLKQCLVKQGLGAYADLLV 562 >gb|PPS11919.1| hypothetical protein GOBAR_AA08740 [Gossypium barbadense] Length = 564 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLS+ERVRQLE+RALYK+K+ LV QGL AYA+LL+ Sbjct: 529 FGLSKERVRQLESRALYKLKQCLVKQGLGAYADLLV 564 >gb|PPD67093.1| hypothetical protein GOBAR_DD36029 [Gossypium barbadense] Length = 564 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLS+ERVRQLE+RALYK+K+ LV QGL AYA+LL+ Sbjct: 529 FGLSKERVRQLESRALYKLKQCLVKQGLGAYADLLV 564 >ref|XP_017603237.1| PREDICTED: RNA polymerase sigma factor sigF, chloroplastic-like isoform X1 [Gossypium arboreum] Length = 564 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLS+ERVRQLE+RALYK+K+ LV QGL AYA+LL+ Sbjct: 529 FGLSKERVRQLESRALYKLKQCLVKQGLGAYADLLV 564 >ref|XP_016723149.1| PREDICTED: RNA polymerase sigma factor sigF, chloroplastic-like isoform X1 [Gossypium hirsutum] Length = 564 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLS+ERVRQLE+RALYK+K+ LV QGL AYA+LL+ Sbjct: 529 FGLSKERVRQLESRALYKLKQCLVKQGLGAYADLLV 564 >ref|XP_012485937.1| PREDICTED: RNA polymerase sigma factor sigF, chloroplastic-like isoform X1 [Gossypium raimondii] gb|KJB36541.1| hypothetical protein B456_006G165200 [Gossypium raimondii] Length = 564 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLS+ERVRQLE+RALYK+K+ LV QGL AYA+LL+ Sbjct: 529 FGLSKERVRQLESRALYKLKQCLVKQGLGAYADLLV 564 >gb|KHG01807.1| RNA polymerase sigma factor rpoD [Gossypium arboreum] Length = 564 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 400 FGLSRERVRQLENRALYKIKKRLVSQGLNAYANLLI 293 FGLS+ERVRQLE+RALYK+K+ LV QGL AYA+LL+ Sbjct: 529 FGLSKERVRQLESRALYKLKQCLVKQGLGAYADLLV 564