BLASTX nr result
ID: Astragalus23_contig00010994
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00010994 (548 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004498978.1| PREDICTED: phytosulfokines-like [Cicer ariet... 54 1e-06 ref|XP_013465972.1| phytosulfokine precursor protein [Medicago t... 54 3e-06 >ref|XP_004498978.1| PREDICTED: phytosulfokines-like [Cicer arietinum] Length = 80 Score = 54.3 bits (129), Expect = 1e-06 Identities = 32/63 (50%), Positives = 38/63 (60%) Frame = -2 Query: 415 RSNLGFQSVSSLHKDVADSKKWGAEMXXXXXXXXXXXXXXCLTRRTLAAHLDYIYTQKHK 236 R NLGF+ VSSLH+DV +K E+ LTRRTLAAH+DYIYTQ +K Sbjct: 23 RPNLGFKGVSSLHEDVVVNKALSEELDDESCEGEEEC----LTRRTLAAHIDYIYTQ-NK 77 Query: 235 PNN 227 P N Sbjct: 78 PKN 80 >ref|XP_013465972.1| phytosulfokine precursor protein [Medicago truncatula] gb|KEH40008.1| phytosulfokine precursor protein [Medicago truncatula] Length = 83 Score = 53.5 bits (127), Expect = 3e-06 Identities = 31/63 (49%), Positives = 36/63 (57%) Frame = -2 Query: 415 RSNLGFQSVSSLHKDVADSKKWGAEMXXXXXXXXXXXXXXCLTRRTLAAHLDYIYTQKHK 236 R N F+ VSSLH+D+ SK ++ LTRRTLAAHLDYIYTQ HK Sbjct: 23 RPNFVFKGVSSLHEDIVSSKASSVDLEDENCEGVEGEQEC-LTRRTLAAHLDYIYTQ-HK 80 Query: 235 PNN 227 P N Sbjct: 81 PKN 83