BLASTX nr result
ID: Astragalus23_contig00010848
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00010848 (431 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN05282.1| Pentatricopeptide repeat-containing protein [Glyc... 63 9e-09 gb|KRH12777.1| hypothetical protein GLYMA_15G193700 [Glycine max] 63 9e-09 ref|XP_003547574.1| PREDICTED: pentatricopeptide repeat-containi... 63 9e-09 ref|XP_020203036.1| pentatricopeptide repeat-containing protein ... 61 4e-08 ref|XP_004503357.1| PREDICTED: pentatricopeptide repeat-containi... 61 4e-08 ref|XP_003630936.1| PPR containing plant-like protein [Medicago ... 61 4e-08 ref|XP_021644520.1| pentatricopeptide repeat-containing protein ... 60 1e-07 ref|XP_021644525.1| pentatricopeptide repeat-containing protein ... 60 1e-07 gb|PNY11660.1| pentatricopeptide repeat-containing protein at4g2... 60 1e-07 gb|KYP39482.1| Pentatricopeptide repeat-containing protein At4g2... 59 3e-07 ref|XP_019415839.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-07 gb|OIV98311.1| hypothetical protein TanjilG_16638 [Lupinus angus... 59 3e-07 ref|XP_020993590.1| pentatricopeptide repeat-containing protein ... 58 7e-07 ref|XP_016188503.2| LOW QUALITY PROTEIN: pentatricopeptide repea... 58 7e-07 ref|XP_021614895.1| pentatricopeptide repeat-containing protein ... 58 7e-07 gb|KHN41349.1| Pentatricopeptide repeat-containing protein [Glyc... 57 9e-07 ref|XP_006587119.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 gb|EEF28596.1| pentatricopeptide repeat-containing protein, puta... 57 2e-06 ref|XP_002533783.2| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_019077990.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 >gb|KHN05282.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 772 Score = 63.2 bits (152), Expect = 9e-09 Identities = 38/85 (44%), Positives = 49/85 (57%), Gaps = 2/85 (2%) Frame = -3 Query: 390 YPKSLLNIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSFK-L 217 + + N V +YSK G+ FD KL MP T TVTW+ L+ GY Q T+E F + Sbjct: 205 FDPQVANTLVAMYSKCGNLFDARKLFNTMPQTDTVTWNGLIAGYVQNGFTDEAAPLFNAM 264 Query: 216 ISAEVKPELLVFVSSLPYVFESVSL 142 ISA VKP+ + F S LP + ES SL Sbjct: 265 ISAGVKPDSVTFASFLPSILESGSL 289 >gb|KRH12777.1| hypothetical protein GLYMA_15G193700 [Glycine max] Length = 825 Score = 63.2 bits (152), Expect = 9e-09 Identities = 38/85 (44%), Positives = 49/85 (57%), Gaps = 2/85 (2%) Frame = -3 Query: 390 YPKSLLNIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSFK-L 217 + + N V +YSK G+ FD KL MP T TVTW+ L+ GY Q T+E F + Sbjct: 258 FDPQVANTLVAMYSKCGNLFDARKLFNTMPQTDTVTWNGLIAGYVQNGFTDEAAPLFNAM 317 Query: 216 ISAEVKPELLVFVSSLPYVFESVSL 142 ISA VKP+ + F S LP + ES SL Sbjct: 318 ISAGVKPDSVTFASFLPSILESGSL 342 >ref|XP_003547574.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] Length = 846 Score = 63.2 bits (152), Expect = 9e-09 Identities = 38/85 (44%), Positives = 49/85 (57%), Gaps = 2/85 (2%) Frame = -3 Query: 390 YPKSLLNIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSFK-L 217 + + N V +YSK G+ FD KL MP T TVTW+ L+ GY Q T+E F + Sbjct: 279 FDPQVANTLVAMYSKCGNLFDARKLFNTMPQTDTVTWNGLIAGYVQNGFTDEAAPLFNAM 338 Query: 216 ISAEVKPELLVFVSSLPYVFESVSL 142 ISA VKP+ + F S LP + ES SL Sbjct: 339 ISAGVKPDSVTFASFLPSILESGSL 363 >ref|XP_020203036.1| pentatricopeptide repeat-containing protein At4g21300 [Cajanus cajan] ref|XP_020203037.1| pentatricopeptide repeat-containing protein At4g21300 [Cajanus cajan] ref|XP_020203038.1| pentatricopeptide repeat-containing protein At4g21300 [Cajanus cajan] ref|XP_020203039.1| pentatricopeptide repeat-containing protein At4g21300 [Cajanus cajan] ref|XP_020203041.1| pentatricopeptide repeat-containing protein At4g21300 [Cajanus cajan] Length = 849 Score = 61.2 bits (147), Expect = 4e-08 Identities = 36/85 (42%), Positives = 49/85 (57%), Gaps = 2/85 (2%) Frame = -3 Query: 390 YPKSLLNIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSFK-L 217 + + N V +YSK G+ FD KL +MP T TVTW+ L+ GY Q T+E F + Sbjct: 282 FDSQVANTLVAMYSKCGNLFDARKLFNIMPQTDTVTWNGLIAGYVQNGFTDEAAPLFNAM 341 Query: 216 ISAEVKPELLVFVSSLPYVFESVSL 142 IS VKP+ + F S LP + +S SL Sbjct: 342 ISVGVKPDSVTFASFLPSILKSGSL 366 >ref|XP_004503357.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Cicer arietinum] ref|XP_012572043.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Cicer arietinum] Length = 875 Score = 61.2 bits (147), Expect = 4e-08 Identities = 40/92 (43%), Positives = 53/92 (57%), Gaps = 2/92 (2%) Frame = -3 Query: 378 LLNIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSFK-LISAE 205 L N +T+YSK G+ F KL M T TVTW+ L+ GY Q T+E V FK +I++ Sbjct: 312 LANTLITMYSKCGNLFYARKLFDTMLQTDTVTWNGLIAGYVQNGFTDEAVTLFKAMIASG 371 Query: 204 VKPELLVFVSSLPYVFESVSLPAGPNCRRGQS 109 VKP+ + F S LP + ES SL NC+ S Sbjct: 372 VKPDSITFASFLPSILESGSL---NNCKEVHS 400 >ref|XP_003630936.1| PPR containing plant-like protein [Medicago truncatula] gb|AET05412.1| PPR containing plant-like protein [Medicago truncatula] Length = 959 Score = 61.2 bits (147), Expect = 4e-08 Identities = 35/82 (42%), Positives = 52/82 (63%), Gaps = 2/82 (2%) Frame = -3 Query: 381 SLLNIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSFK-LISA 208 ++ N +T+YSK G+ FD K+ +MP T TVTW+ L+ GY Q T+E V FK ++++ Sbjct: 314 TVANTIITMYSKCGNLFDARKIFDIMPQTDTVTWNGLIAGYVQNGFTDEAVALFKAMVTS 373 Query: 207 EVKPELLVFVSSLPYVFESVSL 142 VK + + F S LP V +S SL Sbjct: 374 GVKLDSITFASFLPSVLKSGSL 395 >ref|XP_021644520.1| pentatricopeptide repeat-containing protein At4g21300 isoform X1 [Hevea brasiliensis] ref|XP_021644521.1| pentatricopeptide repeat-containing protein At4g21300 isoform X1 [Hevea brasiliensis] ref|XP_021644522.1| pentatricopeptide repeat-containing protein At4g21300 isoform X1 [Hevea brasiliensis] ref|XP_021644523.1| pentatricopeptide repeat-containing protein At4g21300 isoform X1 [Hevea brasiliensis] ref|XP_021644524.1| pentatricopeptide repeat-containing protein At4g21300 isoform X1 [Hevea brasiliensis] Length = 657 Score = 60.1 bits (144), Expect = 1e-07 Identities = 39/110 (35%), Positives = 56/110 (50%), Gaps = 2/110 (1%) Frame = -3 Query: 372 NIQVTIYSKYGSPFDTSKLLM-MPHTYTVTWSALLDGYAQIRVTNEVVFSF-KLISAEVK 199 N V +YSK G FD KL MP T VTW+ ++ G+ Q NE F ++I+A VK Sbjct: 115 NTLVAMYSKCGQLFDARKLFRTMPETSVVTWNGMIAGHVQNGFMNEASHLFSEMIAAGVK 174 Query: 198 PELLVFVSSLPYVFESVSLPAGPNCRRGQSLDGRLTLWDCRMGLATTNGL 49 P+ + S LP + ES SL R+G+ + G + D + L + L Sbjct: 175 PDSITLASFLPSIIESASL------RQGKEIHGYMVRHDVTLDLFLKSAL 218 >ref|XP_021644525.1| pentatricopeptide repeat-containing protein At4g21300 isoform X2 [Hevea brasiliensis] Length = 832 Score = 60.1 bits (144), Expect = 1e-07 Identities = 39/110 (35%), Positives = 56/110 (50%), Gaps = 2/110 (1%) Frame = -3 Query: 372 NIQVTIYSKYGSPFDTSKLLM-MPHTYTVTWSALLDGYAQIRVTNEVVFSF-KLISAEVK 199 N V +YSK G FD KL MP T VTW+ ++ G+ Q NE F ++I+A VK Sbjct: 290 NTLVAMYSKCGQLFDARKLFRTMPETSVVTWNGMIAGHVQNGFMNEASHLFSEMIAAGVK 349 Query: 198 PELLVFVSSLPYVFESVSLPAGPNCRRGQSLDGRLTLWDCRMGLATTNGL 49 P+ + S LP + ES SL R+G+ + G + D + L + L Sbjct: 350 PDSITLASFLPSIIESASL------RQGKEIHGYMVRHDVTLDLFLKSAL 393 >gb|PNY11660.1| pentatricopeptide repeat-containing protein at4g21300-like protein [Trifolium pratense] Length = 768 Score = 59.7 bits (143), Expect = 1e-07 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 2/81 (2%) Frame = -3 Query: 378 LLNIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSFK-LISAE 205 L N +T+YSK G+ FD KL M T TVTW+ L+ GY Q T+E V FK +I++ Sbjct: 199 LANTLITMYSKCGNLFDARKLFDRMTQTDTVTWNGLIAGYVQNGFTDEAVALFKAMIASG 258 Query: 204 VKPELLVFVSSLPYVFESVSL 142 VK + + F S LP + ES +L Sbjct: 259 VKLDSITFASFLPSILESGTL 279 >gb|KYP39482.1| Pentatricopeptide repeat-containing protein At4g21300 family [Cajanus cajan] Length = 724 Score = 58.9 bits (141), Expect = 3e-07 Identities = 34/78 (43%), Positives = 47/78 (60%), Gaps = 2/78 (2%) Frame = -3 Query: 369 IQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSFK-LISAEVKP 196 ++ +YSK G+ FD KL +MP T TVTW+ L+ GY Q T+E F +IS VKP Sbjct: 205 VKFAMYSKCGNLFDARKLFNIMPQTDTVTWNGLIAGYVQNGFTDEAAPLFNAMISVGVKP 264 Query: 195 ELLVFVSSLPYVFESVSL 142 + + F S LP + +S SL Sbjct: 265 DSVTFASFLPSILKSGSL 282 >ref|XP_019415839.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Lupinus angustifolius] ref|XP_019415840.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Lupinus angustifolius] ref|XP_019415841.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Lupinus angustifolius] Length = 857 Score = 58.9 bits (141), Expect = 3e-07 Identities = 36/88 (40%), Positives = 48/88 (54%), Gaps = 2/88 (2%) Frame = -3 Query: 390 YPKSLLNIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSFK-L 217 + + N + +YSK G F KL MP TVTW+ L+ GY Q T+E V FK + Sbjct: 285 FDSQVANTLLAMYSKCGDLFYARKLFNTMPQIDTVTWNGLIAGYVQNGFTDEAVPLFKEM 344 Query: 216 ISAEVKPELLVFVSSLPYVFESVSLPAG 133 IS VKP+ + F S LP + ES S+ G Sbjct: 345 ISTGVKPDSITFASFLPSIVESGSIKRG 372 >gb|OIV98311.1| hypothetical protein TanjilG_16638 [Lupinus angustifolius] Length = 929 Score = 58.9 bits (141), Expect = 3e-07 Identities = 36/88 (40%), Positives = 48/88 (54%), Gaps = 2/88 (2%) Frame = -3 Query: 390 YPKSLLNIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSFK-L 217 + + N + +YSK G F KL MP TVTW+ L+ GY Q T+E V FK + Sbjct: 285 FDSQVANTLLAMYSKCGDLFYARKLFNTMPQIDTVTWNGLIAGYVQNGFTDEAVPLFKEM 344 Query: 216 ISAEVKPELLVFVSSLPYVFESVSLPAG 133 IS VKP+ + F S LP + ES S+ G Sbjct: 345 ISTGVKPDSITFASFLPSIVESGSIKRG 372 >ref|XP_020993590.1| pentatricopeptide repeat-containing protein At4g21300 [Arachis duranensis] ref|XP_020993591.1| pentatricopeptide repeat-containing protein At4g21300 [Arachis duranensis] ref|XP_020993592.1| pentatricopeptide repeat-containing protein At4g21300 [Arachis duranensis] ref|XP_020993594.1| pentatricopeptide repeat-containing protein At4g21300 [Arachis duranensis] ref|XP_020993595.1| pentatricopeptide repeat-containing protein At4g21300 [Arachis duranensis] Length = 754 Score = 57.8 bits (138), Expect = 7e-07 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 2/84 (2%) Frame = -3 Query: 390 YPKSLLNIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSFK-L 217 + + N +++YSK G+ D +L MP T TVTW+ L+ GY Q + +E + F + Sbjct: 286 HDSQVANTLLSMYSKCGNLVDARRLFDSMPQTDTVTWNGLIAGYVQNGLADEALTLFNAM 345 Query: 216 ISAEVKPELLVFVSSLPYVFESVS 145 ISA VKP+ + F S LP + ES S Sbjct: 346 ISASVKPDSITFASFLPSIVESGS 369 >ref|XP_016188503.2| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g21300-like [Arachis ipaensis] Length = 810 Score = 57.8 bits (138), Expect = 7e-07 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 2/84 (2%) Frame = -3 Query: 390 YPKSLLNIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSFK-L 217 + + N +++YSK G+ D +L MP T TVTW+ L+ GY Q + +E + F + Sbjct: 286 HDSQVANTLLSMYSKCGNLVDARRLFDSMPQTDTVTWNGLIAGYVQNGLADEALTLFNAM 345 Query: 216 ISAEVKPELLVFVSSLPYVFESVS 145 ISA VKP+ + F S LP + ES S Sbjct: 346 ISASVKPDSITFASFLPSIVESGS 369 >ref|XP_021614895.1| pentatricopeptide repeat-containing protein At4g21300 [Manihot esculenta] ref|XP_021614896.1| pentatricopeptide repeat-containing protein At4g21300 [Manihot esculenta] ref|XP_021614897.1| pentatricopeptide repeat-containing protein At4g21300 [Manihot esculenta] gb|OAY47087.1| hypothetical protein MANES_06G051200 [Manihot esculenta] gb|OAY47088.1| hypothetical protein MANES_06G051200 [Manihot esculenta] gb|OAY47089.1| hypothetical protein MANES_06G051200 [Manihot esculenta] gb|OAY47090.1| hypothetical protein MANES_06G051200 [Manihot esculenta] Length = 845 Score = 57.8 bits (138), Expect = 7e-07 Identities = 37/97 (38%), Positives = 51/97 (52%), Gaps = 7/97 (7%) Frame = -3 Query: 372 NIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSF-KLISAEVK 199 N V +YSK G FD KL +MP T VTW+ ++ G+ Q NE F ++I+A VK Sbjct: 284 NTLVAMYSKCGQLFDARKLFKIMPETSVVTWNGMIAGHVQNGFMNEASHLFSEMIAAGVK 343 Query: 198 PELLVFVSSLPYVFESVSLPAGPN-----CRRGQSLD 103 P+ + S LP V ES ++ G R G +LD Sbjct: 344 PDSITLASFLPSVVESANIKQGKEIHGYVLRHGVNLD 380 >gb|KHN41349.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 788 Score = 57.4 bits (137), Expect = 9e-07 Identities = 36/85 (42%), Positives = 47/85 (55%), Gaps = 2/85 (2%) Frame = -3 Query: 390 YPKSLLNIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSFK-L 217 + + N V +YSK G+ KL MP T TVTW+ L+ GY Q T+E F + Sbjct: 221 FDPQVANTLVAMYSKCGNLLYARKLFNTMPQTDTVTWNGLIAGYVQNGFTDEAAPLFNAM 280 Query: 216 ISAEVKPELLVFVSSLPYVFESVSL 142 ISA VKP+ + F S LP + ES SL Sbjct: 281 ISAGVKPDSVTFASFLPSILESGSL 305 >ref|XP_006587119.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] ref|XP_014617512.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] ref|XP_014617513.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] ref|XP_014617514.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] ref|XP_014617515.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] ref|XP_014617516.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] gb|KRH37767.1| hypothetical protein GLYMA_09G088000 [Glycine max] gb|KRH37768.1| hypothetical protein GLYMA_09G088000 [Glycine max] Length = 848 Score = 57.4 bits (137), Expect = 1e-06 Identities = 36/85 (42%), Positives = 47/85 (55%), Gaps = 2/85 (2%) Frame = -3 Query: 390 YPKSLLNIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSFK-L 217 + + N V +YSK G+ KL MP T TVTW+ L+ GY Q T+E F + Sbjct: 281 FDPQVANTLVAMYSKCGNLLYARKLFNTMPQTDTVTWNGLIAGYVQNGFTDEAAPLFNAM 340 Query: 216 ISAEVKPELLVFVSSLPYVFESVSL 142 ISA VKP+ + F S LP + ES SL Sbjct: 341 ISAGVKPDSVTFASFLPSILESGSL 365 >gb|EEF28596.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 672 Score = 56.6 bits (135), Expect = 2e-06 Identities = 38/97 (39%), Positives = 50/97 (51%), Gaps = 7/97 (7%) Frame = -3 Query: 372 NIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSF-KLISAEVK 199 N V +YSK+G D KL MP T VTW+ ++ G+ Q +E F ++ISA V Sbjct: 112 NALVAMYSKFGQLSDALKLFNTMPDTNVVTWNGMIAGFVQNGFMDEASLLFSEMISAGVS 171 Query: 198 PELLVFVSSLPYVFESVSLPAGPN-----CRRGQSLD 103 P+ + F S LP V ES SL G R G +LD Sbjct: 172 PDSITFASFLPSVTESASLKQGKEIHGYILRHGIALD 208 >ref|XP_002533783.2| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Ricinus communis] Length = 680 Score = 56.6 bits (135), Expect = 2e-06 Identities = 38/97 (39%), Positives = 50/97 (51%), Gaps = 7/97 (7%) Frame = -3 Query: 372 NIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSF-KLISAEVK 199 N V +YSK+G D KL MP T VTW+ ++ G+ Q +E F ++ISA V Sbjct: 120 NALVAMYSKFGQLSDALKLFNTMPDTNVVTWNGMIAGFVQNGFMDEASLLFSEMISAGVS 179 Query: 198 PELLVFVSSLPYVFESVSLPAGPN-----CRRGQSLD 103 P+ + F S LP V ES SL G R G +LD Sbjct: 180 PDSITFASFLPSVTESASLKQGKEIHGYILRHGIALD 216 >ref|XP_019077990.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Vitis vinifera] Length = 853 Score = 55.8 bits (133), Expect = 3e-06 Identities = 36/97 (37%), Positives = 51/97 (52%), Gaps = 7/97 (7%) Frame = -3 Query: 372 NIQVTIYSKYGSPFDTSKLL-MMPHTYTVTWSALLDGYAQIRVTNEVVFSF-KLISAEVK 199 N + +Y+K G FD +L MMP T VTW+ ++ GY Q +E F ++ISA +K Sbjct: 287 NTLLAMYAKCGHLFDARRLFDMMPKTDLVTWNGMISGYVQNGFMDEASCLFHEMISARMK 346 Query: 198 PELLVFVSSLPYVFESVSLPAGPN-----CRRGQSLD 103 P+ + F S LP + E +L G R G SLD Sbjct: 347 PDSITFSSFLPLLSEGATLRQGKEIHCYIIRNGVSLD 383