BLASTX nr result
ID: Astragalus23_contig00010531
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00010531 (313 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN37948.1| RNA polymerase I-specific transcription initiatio... 162 8e-47 ref|XP_020225968.1| RNA polymerase I-specific transcription init... 164 2e-45 ref|XP_004508346.1| PREDICTED: RNA polymerase I-specific transcr... 163 3e-45 gb|KHN38852.1| RNA polymerase I-specific transcription initiatio... 163 4e-45 ref|XP_003534228.1| PREDICTED: RNA polymerase I-specific transcr... 163 4e-45 ref|XP_003547884.1| PREDICTED: RNA polymerase I-specific transcr... 162 6e-45 ref|XP_014490028.1| RNA polymerase I-specific transcription init... 157 5e-43 ref|XP_019421007.1| PREDICTED: RNA polymerase I-specific transcr... 157 8e-43 gb|OIV93820.1| hypothetical protein TanjilG_03783 [Lupinus angus... 157 1e-42 ref|XP_007134114.1| hypothetical protein PHAVU_010G020100g [Phas... 155 2e-42 ref|XP_017442547.1| PREDICTED: RNA polymerase I-specific transcr... 155 4e-42 ref|XP_017442546.1| PREDICTED: RNA polymerase I-specific transcr... 155 4e-42 ref|XP_017421642.1| PREDICTED: RNA polymerase I-specific transcr... 155 4e-42 ref|XP_014516726.1| RNA polymerase I-specific transcription init... 150 3e-40 ref|XP_016180149.1| RNA polymerase I-specific transcription init... 142 2e-37 dbj|GAU41595.1| hypothetical protein TSUD_196640 [Trifolium subt... 142 3e-37 ref|XP_016203135.1| RNA polymerase I-specific transcription init... 140 9e-37 ref|XP_015967676.1| RNA polymerase I-specific transcription init... 140 9e-37 ref|XP_015950816.1| RNA polymerase I-specific transcription init... 139 2e-36 gb|KDO71564.1| hypothetical protein CISIN_1g0157612mg, partial [... 126 8e-35 >gb|KHN37948.1| RNA polymerase I-specific transcription initiation factor RRN3 [Glycine soja] Length = 368 Score = 162 bits (411), Expect = 8e-47 Identities = 76/104 (73%), Positives = 93/104 (89%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 GAVSYID HH++LLFAVSR+SLWN+ D++DALLELI+SLA SNGKYI+WCLE+LV+ F Sbjct: 74 GAVSYIDSVHHESLLFAVSRMSLWNYGIDIMDALLELIISLAASNGKYIDWCLEMLVKHF 133 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 VPP +L D +++ NG+D KNKV+SRVHAALK+IADLVPLAPLRL Sbjct: 134 VPPFYLLDSLRQENGIDRKNKVLSRVHAALKEIADLVPLAPLRL 177 >ref|XP_020225968.1| RNA polymerase I-specific transcription initiation factor RRN3 [Cajanus cajan] gb|KYP55032.1| RNA polymerase I-specific transcription initiation factor RRN3 [Cajanus cajan] Length = 623 Score = 164 bits (415), Expect = 2e-45 Identities = 78/104 (75%), Positives = 92/104 (88%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 GA SYID HH+ALLFAVSR+SLWN+ TDV+DALLELI+SLA SNGKYI+WCLE+LV+ F Sbjct: 74 GAASYIDSVHHEALLFAVSRMSLWNYGTDVMDALLELIISLAASNGKYIDWCLEMLVKHF 133 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 VPP +L D +K+ NG+D K KV+SRVHAALK+IADLVPLAPLRL Sbjct: 134 VPPYYLLDSLKQENGIDRKTKVLSRVHAALKEIADLVPLAPLRL 177 >ref|XP_004508346.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Cicer arietinum] ref|XP_004508347.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Cicer arietinum] ref|XP_004508348.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Cicer arietinum] Length = 620 Score = 163 bits (413), Expect = 3e-45 Identities = 79/104 (75%), Positives = 93/104 (89%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 GAVSYID AHHDALLFA+SR+SLWN+ T V+DALLELIVSLAVSNG YI+WCLE+LV+ F Sbjct: 75 GAVSYIDPAHHDALLFALSRLSLWNYATVVMDALLELIVSLAVSNGMYIDWCLEMLVKHF 134 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 VPP +L D +K NG++ KNKV+SRVHAAL+QI+DLVPLAPLRL Sbjct: 135 VPPIYLFDFLKETNGIEKKNKVLSRVHAALEQISDLVPLAPLRL 178 >gb|KHN38852.1| RNA polymerase I-specific transcription initiation factor RRN3 [Glycine soja] Length = 628 Score = 163 bits (412), Expect = 4e-45 Identities = 77/104 (74%), Positives = 94/104 (90%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 GAVSYID HH++LLFAVSR+SLWN D++DALLELI+SLAVSNGKYI+WCLE+LV++F Sbjct: 74 GAVSYIDSVHHESLLFAVSRMSLWNCGIDIMDALLELIISLAVSNGKYIDWCLEMLVKNF 133 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 VPP +L D +++ NG+D KNKV+SRVHAALK+IADLVPLAPLRL Sbjct: 134 VPPFYLLDSLRQENGIDRKNKVLSRVHAALKEIADLVPLAPLRL 177 >ref|XP_003534228.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Glycine max] gb|KRH39394.1| hypothetical protein GLYMA_09G196200 [Glycine max] gb|KRH39395.1| hypothetical protein GLYMA_09G196200 [Glycine max] Length = 628 Score = 163 bits (412), Expect = 4e-45 Identities = 77/104 (74%), Positives = 94/104 (90%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 GAVSYID HH++LLFAVSR+SLWN D++DALLELI+SLAVSNGKYI+WCLE+LV++F Sbjct: 74 GAVSYIDSVHHESLLFAVSRMSLWNCGIDIMDALLELIISLAVSNGKYIDWCLEMLVKNF 133 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 VPP +L D +++ NG+D KNKV+SRVHAALK+IADLVPLAPLRL Sbjct: 134 VPPFYLLDSLRQENGIDRKNKVLSRVHAALKEIADLVPLAPLRL 177 >ref|XP_003547884.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 [Glycine max] ref|XP_006599254.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 [Glycine max] gb|KRH07819.1| hypothetical protein GLYMA_16G112800 [Glycine max] gb|KRH07820.1| hypothetical protein GLYMA_16G112800 [Glycine max] Length = 627 Score = 162 bits (411), Expect = 6e-45 Identities = 76/104 (73%), Positives = 93/104 (89%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 GAVSYID HH++LLFAVSR+SLWN+ D++DALLELI+SLA SNGKYI+WCLE+LV+ F Sbjct: 74 GAVSYIDSVHHESLLFAVSRMSLWNYGIDIMDALLELIISLAASNGKYIDWCLEMLVKHF 133 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 VPP +L D +++ NG+D KNKV+SRVHAALK+IADLVPLAPLRL Sbjct: 134 VPPFYLLDSLRQENGIDRKNKVLSRVHAALKEIADLVPLAPLRL 177 >ref|XP_014490028.1| RNA polymerase I-specific transcription initiation factor RRN3 [Vigna radiata var. radiata] ref|XP_014490029.1| RNA polymerase I-specific transcription initiation factor RRN3 [Vigna radiata var. radiata] Length = 620 Score = 157 bits (397), Expect = 5e-43 Identities = 74/104 (71%), Positives = 92/104 (88%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 GAVSYID HH++LLFAVSR+SLWN+ T+V+DALLELI SLA +NGKYI+WCLE+LV+ F Sbjct: 74 GAVSYIDSDHHESLLFAVSRMSLWNYGTEVMDALLELITSLAATNGKYIDWCLEMLVKHF 133 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 VPP ++ D + + NG++ KNKV+SRVHAALK+IADLVPLAPLRL Sbjct: 134 VPPFYIYDSLDKENGINRKNKVLSRVHAALKEIADLVPLAPLRL 177 >ref|XP_019421007.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Lupinus angustifolius] Length = 619 Score = 157 bits (396), Expect = 8e-43 Identities = 77/104 (74%), Positives = 90/104 (86%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 GA SYID A+H+ALLFAVSR+SLWN+ TDV+DALLELI+SLA SNGKYI+WCLE+LV++F Sbjct: 77 GAASYIDSAYHEALLFAVSRMSLWNYGTDVMDALLELIISLAASNGKYIDWCLEMLVKNF 136 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 VPP D+ K NG+D KNKV+ RVHAALK IADLVPLAPLRL Sbjct: 137 VPP--YFDITKHENGIDKKNKVLPRVHAALKDIADLVPLAPLRL 178 >gb|OIV93820.1| hypothetical protein TanjilG_03783 [Lupinus angustifolius] Length = 656 Score = 157 bits (396), Expect = 1e-42 Identities = 77/104 (74%), Positives = 90/104 (86%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 GA SYID A+H+ALLFAVSR+SLWN+ TDV+DALLELI+SLA SNGKYI+WCLE+LV++F Sbjct: 77 GAASYIDSAYHEALLFAVSRMSLWNYGTDVMDALLELIISLAASNGKYIDWCLEMLVKNF 136 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 VPP D+ K NG+D KNKV+ RVHAALK IADLVPLAPLRL Sbjct: 137 VPP--YFDITKHENGIDKKNKVLPRVHAALKDIADLVPLAPLRL 178 >ref|XP_007134114.1| hypothetical protein PHAVU_010G020100g [Phaseolus vulgaris] gb|ESW06108.1| hypothetical protein PHAVU_010G020100g [Phaseolus vulgaris] Length = 620 Score = 155 bits (393), Expect = 2e-42 Identities = 75/104 (72%), Positives = 90/104 (86%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 GAV ID HH++LLFAVSR+SLWN+ T+V+DALLELI+SLA SNGKYI+WCLE+LV+ F Sbjct: 74 GAVCCIDPNHHESLLFAVSRMSLWNYGTEVMDALLELIISLAASNGKYIDWCLEMLVKHF 133 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 VPP +L D + NG+D KNKV+SRVHAALK+IADLVPLAPLRL Sbjct: 134 VPPFYLIDSLNNENGIDRKNKVLSRVHAALKEIADLVPLAPLRL 177 >ref|XP_017442547.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like isoform X2 [Vigna angularis] Length = 610 Score = 155 bits (391), Expect = 4e-42 Identities = 73/104 (70%), Positives = 91/104 (87%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 GAVSYID HH++LLFAVS++SLWN+ T+V+DALLELI SLA +NGKYI+WCLE+LV+ F Sbjct: 74 GAVSYIDSDHHESLLFAVSKMSLWNYGTEVMDALLELITSLAATNGKYIDWCLEMLVKHF 133 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 VPP ++ D + NG++ KNKV+SRVHAALK+IADLVPLAPLRL Sbjct: 134 VPPFNIYDSLDNENGINRKNKVLSRVHAALKEIADLVPLAPLRL 177 >ref|XP_017442546.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like isoform X1 [Vigna angularis] gb|KOM58311.1| hypothetical protein LR48_Vigan11g134500 [Vigna angularis] dbj|BAT97145.1| hypothetical protein VIGAN_09051000 [Vigna angularis var. angularis] Length = 620 Score = 155 bits (391), Expect = 4e-42 Identities = 73/104 (70%), Positives = 91/104 (87%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 GAVSYID HH++LLFAVS++SLWN+ T+V+DALLELI SLA +NGKYI+WCLE+LV+ F Sbjct: 74 GAVSYIDSDHHESLLFAVSKMSLWNYGTEVMDALLELITSLAATNGKYIDWCLEMLVKHF 133 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 VPP ++ D + NG++ KNKV+SRVHAALK+IADLVPLAPLRL Sbjct: 134 VPPFNIYDSLDNENGINRKNKVLSRVHAALKEIADLVPLAPLRL 177 >ref|XP_017421642.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Vigna angularis] ref|XP_017421643.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Vigna angularis] ref|XP_017421644.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Vigna angularis] ref|XP_017421645.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Vigna angularis] gb|KOM41314.1| hypothetical protein LR48_Vigan04g151200 [Vigna angularis] dbj|BAT79328.1| hypothetical protein VIGAN_02219700 [Vigna angularis var. angularis] Length = 621 Score = 155 bits (391), Expect = 4e-42 Identities = 73/104 (70%), Positives = 90/104 (86%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 GAVSYID HH++LLFAVS +SLWN+ T+V+DALLELI SLA +NGKYI+WCLE+LV+ F Sbjct: 74 GAVSYIDSDHHESLLFAVSGMSLWNYGTEVMDALLELITSLAATNGKYIDWCLEMLVKHF 133 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 VPP ++ D + NG++ KNKV+SRVHAALK+IADLVPLAPLRL Sbjct: 134 VPPRYIYDSLDNENGINRKNKVLSRVHAALKEIADLVPLAPLRL 177 >ref|XP_014516726.1| RNA polymerase I-specific transcription initiation factor RRN3-like [Vigna radiata var. radiata] Length = 623 Score = 150 bits (378), Expect = 3e-40 Identities = 72/104 (69%), Positives = 89/104 (85%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 GAVSYID HH++LLFAVSR+SLWN+ T+V+DALLELI SLA +NGKYI+WCLE+LV+ F Sbjct: 74 GAVSYIDSDHHESLLFAVSRMSLWNNGTEVMDALLELITSLAATNGKYIDWCLEMLVKHF 133 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 VPP ++ + NG + KNKV+SRVHAAL++IADLVPLAPLRL Sbjct: 134 VPPFYMHGSLDNENGNNWKNKVLSRVHAALEEIADLVPLAPLRL 177 >ref|XP_016180149.1| RNA polymerase I-specific transcription initiation factor RRN3 [Arachis ipaensis] Length = 621 Score = 142 bits (358), Expect = 2e-37 Identities = 68/104 (65%), Positives = 85/104 (81%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 G VS ID HH++LL AV R+SLWN+ T ++DAL+ELIVSLA SNGKYI+W LE+LV +F Sbjct: 74 GTVSCIDSVHHESLLSAVYRMSLWNYGTSIMDALVELIVSLAASNGKYIDWSLEMLVNNF 133 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 PPNHL D +K+ +G++ KNKV+SRVHAA + IA LVPLAPLRL Sbjct: 134 TPPNHLMDSLKQESGIEKKNKVLSRVHAAFEAIAVLVPLAPLRL 177 >dbj|GAU41595.1| hypothetical protein TSUD_196640 [Trifolium subterraneum] Length = 635 Score = 142 bits (357), Expect = 3e-37 Identities = 69/112 (61%), Positives = 87/112 (77%), Gaps = 8/112 (7%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHR--------TDVLDALLELIVSLAVSNGKYIEWC 156 G VSYI+ HH+ L+FA+SR+SLWN+ TD++DA+LELIVSLAVS G I+WC Sbjct: 75 GVVSYINPVHHETLIFALSRLSLWNYAATDSKYDGTDIMDAVLELIVSLAVSKGNLIDWC 134 Query: 157 LELLVRSFVPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 L++LV+ F PP H+ D ++ NGVD K+KV+SRVH ALKQIADLVPLAPLRL Sbjct: 135 LDVLVKHFSPPRHIFDSLENVNGVDRKDKVLSRVHGALKQIADLVPLAPLRL 186 >ref|XP_016203135.1| RNA polymerase I-specific transcription initiation factor RRN3 [Arachis ipaensis] ref|XP_016203136.1| RNA polymerase I-specific transcription initiation factor RRN3 [Arachis ipaensis] Length = 621 Score = 140 bits (353), Expect = 9e-37 Identities = 68/104 (65%), Positives = 84/104 (80%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 G VS ID HH++LL AV R+SLWN+ T ++DAL+ELIVSLA SNGKYI+W LELLV +F Sbjct: 74 GTVSCIDSVHHESLLSAVYRMSLWNYGTSIMDALIELIVSLAASNGKYIDWSLELLVNNF 133 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 PP HL D +K+ +G++ KNKV+SRVHAA + IA LVPLAPLRL Sbjct: 134 TPPYHLMDSLKQESGIEKKNKVLSRVHAAFEAIAVLVPLAPLRL 177 >ref|XP_015967676.1| RNA polymerase I-specific transcription initiation factor RRN3 [Arachis duranensis] ref|XP_015967677.1| RNA polymerase I-specific transcription initiation factor RRN3 [Arachis duranensis] Length = 621 Score = 140 bits (353), Expect = 9e-37 Identities = 68/104 (65%), Positives = 84/104 (80%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 G VS ID HH++LL AV R+SLWN+ T ++DAL+ELIVSLA SNGKYI+W LELLV +F Sbjct: 74 GTVSCIDSVHHESLLSAVYRMSLWNYGTSIMDALIELIVSLAASNGKYIDWSLELLVNNF 133 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 PP HL D +K+ +G++ KNKV+SRVHAA + IA LVPLAPLRL Sbjct: 134 TPPYHLMDSLKQESGIEKKNKVLSRVHAAFEAIAVLVPLAPLRL 177 >ref|XP_015950816.1| RNA polymerase I-specific transcription initiation factor RRN3 [Arachis duranensis] Length = 621 Score = 139 bits (350), Expect = 2e-36 Identities = 67/104 (64%), Positives = 84/104 (80%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 G VS ID HH++LL AV R+SLWN+ T ++DAL+ELIVSLA SNGKYI+W LE+LV +F Sbjct: 74 GTVSCIDSVHHESLLSAVYRMSLWNYGTSIMDALVELIVSLAASNGKYIDWSLEMLVNNF 133 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 PP HL D +K+ +G++ KNKV+SRVHAA + IA LVPLAPLRL Sbjct: 134 TPPYHLMDSLKQESGIEKKNKVLSRVHAAFEAIAVLVPLAPLRL 177 >gb|KDO71564.1| hypothetical protein CISIN_1g0157612mg, partial [Citrus sinensis] Length = 176 Score = 126 bits (317), Expect = 8e-35 Identities = 57/104 (54%), Positives = 83/104 (79%) Frame = +1 Query: 1 GAVSYIDFAHHDALLFAVSRISLWNHRTDVLDALLELIVSLAVSNGKYIEWCLELLVRSF 180 GAVSYID +HH++LL ++ +S+WN D++DA+ LIVSLA S+GKY++ CL +LV +F Sbjct: 33 GAVSYIDISHHESLLVSIFGMSMWNSDPDIMDAMKGLIVSLAASDGKYVDSCLTMLVSNF 92 Query: 181 VPPNHLSDLMKRANGVDMKNKVMSRVHAALKQIADLVPLAPLRL 312 PP++ D +K +G++ K++V+SRVHAALK I+DLVPLAP+RL Sbjct: 93 TPPSYFLDKLKEPHGIERKHQVLSRVHAALKSISDLVPLAPMRL 136