BLASTX nr result
ID: Astragalus23_contig00009667
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00009667 (883 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593409.2| S-locus lectin kinase family protein [Medica... 60 3e-06 >ref|XP_003593409.2| S-locus lectin kinase family protein [Medicago truncatula] gb|AES63660.2| S-locus lectin kinase family protein [Medicago truncatula] Length = 787 Score = 59.7 bits (143), Expect = 3e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = +3 Query: 3 EYVCYGAYGTCIIKNTPLYKGLNGFEPRRWHECNMLEWSRGYVK 134 +Y GAYGTC IKN+P+ K LNGFEPR H+ ML+WS G V+ Sbjct: 293 DYGICGAYGTCNIKNSPICKCLNGFEPRNMHDWKMLDWSSGCVR 336