BLASTX nr result
ID: Astragalus23_contig00009604
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00009604 (991 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN04149.1| Protein DA1-related 1 [Glycine soja] 94 8e-18 gb|KRH26214.1| hypothetical protein GLYMA_12G160000 [Glycine max] 94 8e-18 gb|AKI32353.1| DA-related 1 protein 2, partial [Glycine max] 94 2e-17 gb|POO02619.1| Zinc finger, LIM-type [Trema orientalis] 91 3e-17 gb|PON37433.1| Zinc finger, LIM-type [Parasponia andersonii] 91 3e-17 gb|KRH69970.1| hypothetical protein GLYMA_02G059900 [Glycine max] 93 3e-17 gb|KYP42663.1| LIM and UIM domain-containing At1g19270 family [C... 93 4e-17 gb|KHN00570.1| Protein DA1-related 1 [Glycine soja] 93 4e-17 ref|XP_020239306.1| protein DA1-related 1-like [Cajanus cajan] >... 91 1e-16 ref|XP_007156007.1| hypothetical protein PHAVU_003G250800g [Phas... 91 1e-16 gb|PPD91589.1| hypothetical protein GOBAR_DD11469 [Gossypium bar... 91 2e-16 ref|XP_014620236.1| PREDICTED: protein DA1-related 1-like [Glyci... 90 2e-16 ref|XP_015961399.1| protein DA1-related 1 [Arachis duranensis] 91 2e-16 ref|XP_016184265.1| protein DA1-related 1 [Arachis ipaensis] 91 2e-16 ref|XP_019432107.1| PREDICTED: protein DA1-related 1-like [Lupin... 90 3e-16 gb|AKI32346.1| DA-related 1 protein 6, partial [Glycine soja] >g... 90 3e-16 gb|AKI32342.1| DA-related 1 protein 2, partial [Glycine soja] 90 3e-16 ref|XP_006574708.1| PREDICTED: protein DA1-related 1-like [Glyci... 90 3e-16 gb|KQK14111.1| hypothetical protein BRADI_1g14360v3 [Brachypodiu... 76 3e-16 ref|XP_017405669.1| PREDICTED: protein DA1-related 1-like [Vigna... 90 4e-16 >gb|KHN04149.1| Protein DA1-related 1 [Glycine soja] Length = 389 Score = 94.0 bits (232), Expect = 8e-18 Identities = 46/76 (60%), Positives = 52/76 (68%), Gaps = 9/76 (11%) Frame = -2 Query: 342 CNVNILDGRY-AVFGYVTENEGY--------LADLKIPPNSAGLIEYRAHPFWLQKYCPS 190 CN I GR+ + G E + + D +IPPNSAGLIEYRAHPFWLQKYCPS Sbjct: 121 CNAEISHGRFLSCMGGYWHPECFCCHACKLPITDYEIPPNSAGLIEYRAHPFWLQKYCPS 180 Query: 189 HERDGTPR*CSCQRME 142 HERDGTPR CSCQR+E Sbjct: 181 HERDGTPRCCSCQRLE 196 >gb|KRH26214.1| hypothetical protein GLYMA_12G160000 [Glycine max] Length = 396 Score = 94.0 bits (232), Expect = 8e-18 Identities = 46/76 (60%), Positives = 52/76 (68%), Gaps = 9/76 (11%) Frame = -2 Query: 342 CNVNILDGRY-AVFGYVTENEGY--------LADLKIPPNSAGLIEYRAHPFWLQKYCPS 190 CN I GR+ + G E + + D +IPPNSAGLIEYRAHPFWLQKYCPS Sbjct: 168 CNAEISHGRFLSCMGGYWHPECFCCHACKLPITDYEIPPNSAGLIEYRAHPFWLQKYCPS 227 Query: 189 HERDGTPR*CSCQRME 142 HERDGTPR CSCQR+E Sbjct: 228 HERDGTPRCCSCQRLE 243 >gb|AKI32353.1| DA-related 1 protein 2, partial [Glycine max] Length = 532 Score = 93.6 bits (231), Expect = 2e-17 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -2 Query: 261 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR*CSCQRMEVSL 133 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR CSCQR+EVS+ Sbjct: 225 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCQRLEVSV 267 >gb|POO02619.1| Zinc finger, LIM-type [Trema orientalis] Length = 263 Score = 90.5 bits (223), Expect = 3e-17 Identities = 46/79 (58%), Positives = 54/79 (68%), Gaps = 10/79 (12%) Frame = -2 Query: 342 CNVNILDGRYAVFG--------YVTENEGY--LADLKIPPNSAGLIEYRAHPFWLQKYCP 193 CN+ I D +++ G Y +N + + IP NSAGLIEYRAHPFWLQKYCP Sbjct: 185 CNLPITDYEFSMSGNRPYHKSCYKEQNHPRCDVCNNFIPTNSAGLIEYRAHPFWLQKYCP 244 Query: 192 SHERDGTPR*CSCQRMEVS 136 SHERDGTPR CSC+RMEVS Sbjct: 245 SHERDGTPRCCSCERMEVS 263 >gb|PON37433.1| Zinc finger, LIM-type [Parasponia andersonii] Length = 263 Score = 90.5 bits (223), Expect = 3e-17 Identities = 46/79 (58%), Positives = 54/79 (68%), Gaps = 10/79 (12%) Frame = -2 Query: 342 CNVNILDGRYAVFG--------YVTENEGY--LADLKIPPNSAGLIEYRAHPFWLQKYCP 193 CN+ I D +++ G Y +N + + IP NSAGLIEYRAHPFWLQKYCP Sbjct: 185 CNLPITDYEFSMSGNRPYHKSCYKEQNHPRCDVCNNFIPTNSAGLIEYRAHPFWLQKYCP 244 Query: 192 SHERDGTPR*CSCQRMEVS 136 SHERDGTPR CSC+RMEVS Sbjct: 245 SHERDGTPRCCSCERMEVS 263 >gb|KRH69970.1| hypothetical protein GLYMA_02G059900 [Glycine max] Length = 576 Score = 93.2 bits (230), Expect = 3e-17 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 261 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR*CSCQRMEVS 136 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR CSCQR+EVS Sbjct: 225 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCQRLEVS 266 >gb|KYP42663.1| LIM and UIM domain-containing At1g19270 family [Cajanus cajan] Length = 539 Score = 92.8 bits (229), Expect = 4e-17 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 261 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR*CSCQRMEV 139 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR CSCQRMEV Sbjct: 235 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCQRMEV 275 >gb|KHN00570.1| Protein DA1-related 1 [Glycine soja] Length = 1212 Score = 93.2 bits (230), Expect = 4e-17 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 261 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR*CSCQRMEVS 136 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR CSCQR+EVS Sbjct: 225 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCQRLEVS 266 >ref|XP_020239306.1| protein DA1-related 1-like [Cajanus cajan] ref|XP_020239307.1| protein DA1-related 1-like [Cajanus cajan] ref|XP_020239308.1| protein DA1-related 1-like [Cajanus cajan] Length = 529 Score = 91.3 bits (225), Expect = 1e-16 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 261 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR*CSCQRME 142 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR CSCQRME Sbjct: 225 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCQRME 264 >ref|XP_007156007.1| hypothetical protein PHAVU_003G250800g [Phaseolus vulgaris] ref|XP_007156008.1| hypothetical protein PHAVU_003G250800g [Phaseolus vulgaris] gb|ESW28001.1| hypothetical protein PHAVU_003G250800g [Phaseolus vulgaris] gb|ESW28002.1| hypothetical protein PHAVU_003G250800g [Phaseolus vulgaris] Length = 529 Score = 91.3 bits (225), Expect = 1e-16 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 261 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR*CSCQRME 142 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR CSCQRME Sbjct: 225 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCQRME 264 >gb|PPD91589.1| hypothetical protein GOBAR_DD11469 [Gossypium barbadense] Length = 507 Score = 90.9 bits (224), Expect = 2e-16 Identities = 45/76 (59%), Positives = 52/76 (68%), Gaps = 9/76 (11%) Frame = -2 Query: 342 CNVNILDGRY-AVFGYVTENEGY--------LADLKIPPNSAGLIEYRAHPFWLQKYCPS 190 CN I GRY + G V E + + D +IP NSAGLIEYRAHP+W+QKYCPS Sbjct: 165 CNAEIGHGRYLSCMGSVWHPECFRCHACNQPINDYEIPTNSAGLIEYRAHPYWMQKYCPS 224 Query: 189 HERDGTPR*CSCQRME 142 HERDGTPR CSC+RME Sbjct: 225 HERDGTPRCCSCKRME 240 >ref|XP_014620236.1| PREDICTED: protein DA1-related 1-like [Glycine max] Length = 407 Score = 90.1 bits (222), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 261 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR*CSCQRME 142 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR CSCQR+E Sbjct: 225 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCQRLE 264 >ref|XP_015961399.1| protein DA1-related 1 [Arachis duranensis] Length = 523 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/77 (55%), Positives = 52/77 (67%), Gaps = 10/77 (12%) Frame = -2 Query: 342 CNVNILDGRYAVFGYVTENEGYLADLK----------IPPNSAGLIEYRAHPFWLQKYCP 193 CN+ I D +++ G ++ +L IPPNSAGLIEYRAHPFW+QKYCP Sbjct: 198 CNLPITDYEFSMSGNRRYHKSCYKELHHPRCDVCKNFIPPNSAGLIEYRAHPFWMQKYCP 257 Query: 192 SHERDGTPR*CSCQRME 142 SHERDGTPR CSC+RME Sbjct: 258 SHERDGTPRCCSCERME 274 >ref|XP_016184265.1| protein DA1-related 1 [Arachis ipaensis] Length = 541 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/77 (55%), Positives = 52/77 (67%), Gaps = 10/77 (12%) Frame = -2 Query: 342 CNVNILDGRYAVFGYVTENEGYLADLK----------IPPNSAGLIEYRAHPFWLQKYCP 193 CN+ I D +++ G ++ +L IPPNSAGLIEYRAHPFW+QKYCP Sbjct: 198 CNLPITDYEFSMSGNRRYHKSCYKELHHPRCDVCKNFIPPNSAGLIEYRAHPFWMQKYCP 257 Query: 192 SHERDGTPR*CSCQRME 142 SHERDGTPR CSC+RME Sbjct: 258 SHERDGTPRCCSCERME 274 >ref|XP_019432107.1| PREDICTED: protein DA1-related 1-like [Lupinus angustifolius] ref|XP_019432108.1| PREDICTED: protein DA1-related 1-like [Lupinus angustifolius] gb|OIW20988.1| hypothetical protein TanjilG_26782 [Lupinus angustifolius] Length = 520 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 261 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR*CSCQRME 142 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR CSC+RME Sbjct: 218 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERME 257 >gb|AKI32346.1| DA-related 1 protein 6, partial [Glycine soja] gb|AKI32357.1| DA-related 1 protein 6, partial [Glycine max] Length = 526 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 261 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR*CSCQRME 142 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR CSCQR+E Sbjct: 225 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCQRLE 264 >gb|AKI32342.1| DA-related 1 protein 2, partial [Glycine soja] Length = 526 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 261 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR*CSCQRME 142 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR CSCQR+E Sbjct: 225 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCQRLE 264 >ref|XP_006574708.1| PREDICTED: protein DA1-related 1-like [Glycine max] ref|XP_006574709.1| PREDICTED: protein DA1-related 1-like [Glycine max] ref|XP_006574710.1| PREDICTED: protein DA1-related 1-like [Glycine max] ref|XP_006574711.1| PREDICTED: protein DA1-related 1-like [Glycine max] ref|XP_006574712.1| PREDICTED: protein DA1-related 1-like [Glycine max] ref|XP_006574713.1| PREDICTED: protein DA1-related 1-like [Glycine max] ref|XP_014620698.1| PREDICTED: protein DA1-related 1-like [Glycine max] gb|KRH69964.1| hypothetical protein GLYMA_02G059900 [Glycine max] gb|KRH69965.1| hypothetical protein GLYMA_02G059900 [Glycine max] gb|KRH69966.1| hypothetical protein GLYMA_02G059900 [Glycine max] gb|KRH69967.1| hypothetical protein GLYMA_02G059900 [Glycine max] gb|KRH69968.1| hypothetical protein GLYMA_02G059900 [Glycine max] gb|KRH69969.1| hypothetical protein GLYMA_02G059900 [Glycine max] Length = 531 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 261 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR*CSCQRME 142 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR CSCQR+E Sbjct: 225 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCQRLE 264 >gb|KQK14111.1| hypothetical protein BRADI_1g14360v3 [Brachypodium distachyon] Length = 462 Score = 76.3 bits (186), Expect(2) = 3e-16 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -2 Query: 261 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR*CSCQRME 142 I N GLIEYRAHPFW+QKYCPSH+ DGTPR CSC+RME Sbjct: 187 IQTNKNGLIEYRAHPFWMQKYCPSHDNDGTPRCCSCERME 226 Score = 38.1 bits (87), Expect(2) = 3e-16 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -1 Query: 121 KIEQQIPMLLVERQALNEAM 62 K+EQQIP+LLVERQ LNEAM Sbjct: 235 KVEQQIPLLLVERQGLNEAM 254 >ref|XP_017405669.1| PREDICTED: protein DA1-related 1-like [Vigna angularis] ref|XP_017405670.1| PREDICTED: protein DA1-related 1-like [Vigna angularis] ref|XP_017405671.1| PREDICTED: protein DA1-related 1-like [Vigna angularis] gb|KOM25582.1| hypothetical protein LR48_Vigan123s000200 [Vigna angularis] dbj|BAT75506.1| hypothetical protein VIGAN_01337900 [Vigna angularis var. angularis] Length = 531 Score = 89.7 bits (221), Expect = 4e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 261 IPPNSAGLIEYRAHPFWLQKYCPSHERDGTPR*CSCQRME 142 IPPNS GLIEYRAHPFWLQKYCPSHERDGTPR CSCQRME Sbjct: 225 IPPNSGGLIEYRAHPFWLQKYCPSHERDGTPRCCSCQRME 264