BLASTX nr result
ID: Astragalus23_contig00009585
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00009585 (494 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO86313.1| hypothetical protein CISIN_1g0032381mg, partial [... 53 1e-06 gb|OIT27488.1| exocyst complex component sec10 [Nicotiana attenu... 53 4e-06 gb|PPD72153.1| hypothetical protein GOBAR_DD30935 [Gossypium bar... 53 8e-06 >gb|KDO86313.1| hypothetical protein CISIN_1g0032381mg, partial [Citrus sinensis] Length = 53 Score = 53.1 bits (126), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 492 LSTLFEGTPSIRKDAQRFIQLREDY 418 LSTLFEGTPSIRKDAQRFIQLREDY Sbjct: 12 LSTLFEGTPSIRKDAQRFIQLREDY 36 >gb|OIT27488.1| exocyst complex component sec10 [Nicotiana attenuata] Length = 102 Score = 53.1 bits (126), Expect = 4e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 492 LSTLFEGTPSIRKDAQRFIQLREDY 418 LSTLFEGTPSIRKDAQRFIQLREDY Sbjct: 61 LSTLFEGTPSIRKDAQRFIQLREDY 85 >gb|PPD72153.1| hypothetical protein GOBAR_DD30935 [Gossypium barbadense] Length = 123 Score = 52.8 bits (125), Expect = 8e-06 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -3 Query: 492 LSTLFEGTPSIRKDAQRFIQLREDYXXXXXXXXXXXLWS 376 LS+LFEGTPSIRKDAQRFIQLREDY LWS Sbjct: 82 LSSLFEGTPSIRKDAQRFIQLREDYKSAKLASRLSSLWS 120