BLASTX nr result
ID: Astragalus23_contig00009583
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00009583 (481 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316889.1| hypothetical protein POPTR_0011s11790g [Popu... 52 6e-06 >ref|XP_002316889.1| hypothetical protein POPTR_0011s11790g [Populus trichocarpa] gb|PNT12970.1| hypothetical protein POPTR_011G117000v3 [Populus trichocarpa] Length = 93 Score = 52.4 bits (124), Expect = 6e-06 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = -2 Query: 429 IW--DLRFENLTMKFLFQCPCCSCFCFMKP 346 IW + R + L MKFLFQCPCCSCFCFMKP Sbjct: 47 IWRREERRKRLAMKFLFQCPCCSCFCFMKP 76