BLASTX nr result
ID: Astragalus23_contig00009472
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00009472 (731 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003603209.1| cyclin-like F-box protein [Medicago truncatu... 61 3e-07 >ref|XP_003603209.1| cyclin-like F-box protein [Medicago truncatula] gb|AES73460.1| cyclin-like F-box protein [Medicago truncatula] Length = 373 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 615 TAMPSWRSIPTVDRIGDLPDSLLYHILSFLPIKLAVATS 731 T+ WRSIPTVDRI D+PDS+L HILSFLP KLAV T+ Sbjct: 2 TSFSCWRSIPTVDRISDMPDSILSHILSFLPTKLAVTTT 40