BLASTX nr result
ID: Astragalus23_contig00009003
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00009003 (498 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX61780.1| vesicle-associated protein 4-2-like, partial [Tri... 124 6e-34 dbj|GAU31003.1| hypothetical protein TSUD_105180, partial [Trifo... 124 2e-32 ref|XP_013465026.1| vesicle-associated-like protein [Medicago tr... 120 6e-31 gb|AFK40274.1| unknown [Medicago truncatula] 120 2e-30 ref|XP_013465025.1| vesicle-associated-like protein [Medicago tr... 120 2e-30 ref|XP_004487331.1| PREDICTED: vesicle-associated protein 4-2-li... 114 8e-28 ref|XP_007149895.1| hypothetical protein PHAVU_005G107900g [Phas... 100 1e-22 ref|XP_016170351.1| vesicle-associated protein 4-2 [Arachis ipae... 97 2e-21 ref|XP_015936215.1| vesicle-associated protein 4-2 [Arachis dura... 97 2e-21 gb|KRH26896.1| hypothetical protein GLYMA_12G200900 [Glycine max] 94 4e-21 gb|AFK39696.1| unknown [Lotus japonicus] 96 8e-21 gb|KRH22456.1| hypothetical protein GLYMA_13G301300 [Glycine max] 93 2e-20 ref|XP_003540343.1| PREDICTED: vesicle-associated protein 4-2-li... 94 2e-20 gb|KHN04285.1| Vesicle-associated protein 4-2 [Glycine soja] 94 2e-20 gb|KHN36606.1| Vesicle-associated protein 4-2 [Glycine soja] 93 6e-20 gb|KRH22454.1| hypothetical protein GLYMA_13G301300 [Glycine max... 93 6e-20 ref|NP_001241916.1| uncharacterized protein LOC100794120 [Glycin... 93 6e-20 ref|XP_017425857.1| PREDICTED: vesicle-associated protein 4-2-li... 87 1e-17 ref|XP_017425856.1| PREDICTED: vesicle-associated protein 4-1-li... 87 2e-17 ref|XP_019453744.1| PREDICTED: vesicle-associated protein 4-2-li... 86 3e-17 >gb|PNX61780.1| vesicle-associated protein 4-2-like, partial [Trifolium pratense] Length = 95 Score = 124 bits (311), Expect = 6e-34 Identities = 62/81 (76%), Positives = 64/81 (79%), Gaps = 4/81 (4%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXX----YMHNVHQQNQSLHSID 434 MEVESEKP SDGKVWNFCRMPFWQ++HNP YMHNVH QNQSLHSID Sbjct: 1 MEVESEKPGSDGKVWNFCRMPFWQSSHNPSSSSTTTTTTTSSSSYMHNVHHQNQSLHSID 60 Query: 435 RSVPQSSATVSSVAKSLLPTR 497 RSVPQSSATVSSVAKSLLPTR Sbjct: 61 RSVPQSSATVSSVAKSLLPTR 81 >dbj|GAU31003.1| hypothetical protein TSUD_105180, partial [Trifolium subterraneum] Length = 224 Score = 124 bits (312), Expect = 2e-32 Identities = 63/84 (75%), Positives = 64/84 (76%), Gaps = 7/84 (8%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXX-------YMHNVHQQNQSLH 425 MEVESEKP SDGKVWNFCRMPFWQT+HNP YMHNVH QNQSLH Sbjct: 1 MEVESEKPGSDGKVWNFCRMPFWQTSHNPSSSSTTTTTTTTTSSSSSYMHNVHHQNQSLH 60 Query: 426 SIDRSVPQSSATVSSVAKSLLPTR 497 SIDRSVPQSSATVSSVAKSLLPTR Sbjct: 61 SIDRSVPQSSATVSSVAKSLLPTR 84 >ref|XP_013465026.1| vesicle-associated-like protein [Medicago truncatula] gb|KEH39061.1| vesicle-associated-like protein [Medicago truncatula] Length = 230 Score = 120 bits (302), Expect = 6e-31 Identities = 59/79 (74%), Positives = 64/79 (81%), Gaps = 2/79 (2%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXX--YMHNVHQQNQSLHSIDRS 440 MEVESEKP SDGKVWNFCRMPFWQT++NP YMHNVH Q+QS+HS+DRS Sbjct: 1 MEVESEKPGSDGKVWNFCRMPFWQTSNNPSSSSTTTSSSSTSYMHNVHHQSQSIHSVDRS 60 Query: 441 VPQSSATVSSVAKSLLPTR 497 VPQSSATVSSVAKSLLPTR Sbjct: 61 VPQSSATVSSVAKSLLPTR 79 >gb|AFK40274.1| unknown [Medicago truncatula] Length = 271 Score = 120 bits (302), Expect = 2e-30 Identities = 59/79 (74%), Positives = 64/79 (81%), Gaps = 2/79 (2%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXX--YMHNVHQQNQSLHSIDRS 440 MEVESEKP SDGKVWNFCRMPFWQT++NP YMHNVH Q+QS+HS+DRS Sbjct: 1 MEVESEKPGSDGKVWNFCRMPFWQTSNNPSSSSTTTSSSSTSYMHNVHHQSQSIHSVDRS 60 Query: 441 VPQSSATVSSVAKSLLPTR 497 VPQSSATVSSVAKSLLPTR Sbjct: 61 VPQSSATVSSVAKSLLPTR 79 >ref|XP_013465025.1| vesicle-associated-like protein [Medicago truncatula] gb|ACJ85389.1| unknown [Medicago truncatula] gb|KEH39060.1| vesicle-associated-like protein [Medicago truncatula] Length = 271 Score = 120 bits (302), Expect = 2e-30 Identities = 59/79 (74%), Positives = 64/79 (81%), Gaps = 2/79 (2%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXX--YMHNVHQQNQSLHSIDRS 440 MEVESEKP SDGKVWNFCRMPFWQT++NP YMHNVH Q+QS+HS+DRS Sbjct: 1 MEVESEKPGSDGKVWNFCRMPFWQTSNNPSSSSTTTSSSSTSYMHNVHHQSQSIHSVDRS 60 Query: 441 VPQSSATVSSVAKSLLPTR 497 VPQSSATVSSVAKSLLPTR Sbjct: 61 VPQSSATVSSVAKSLLPTR 79 >ref|XP_004487331.1| PREDICTED: vesicle-associated protein 4-2-like [Cicer arietinum] Length = 272 Score = 114 bits (284), Expect = 8e-28 Identities = 59/81 (72%), Positives = 62/81 (76%), Gaps = 4/81 (4%) Frame = +3 Query: 267 MEVESEKPP-SDGKVWNFCRMPFWQTNHNPXXXXXXXXXXX---YMHNVHQQNQSLHSID 434 MEVESEKP SDGKVWNFCRMPFWQT+HNP YMHNVH Q+QSLHS+D Sbjct: 1 MEVESEKPGGSDGKVWNFCRMPFWQTSHNPSSSSITTTSSSSTSYMHNVHHQSQSLHSLD 60 Query: 435 RSVPQSSATVSSVAKSLLPTR 497 RS QSSATVSSVAKSLLPTR Sbjct: 61 RSTHQSSATVSSVAKSLLPTR 81 >ref|XP_007149895.1| hypothetical protein PHAVU_005G107900g [Phaseolus vulgaris] gb|ESW21889.1| hypothetical protein PHAVU_005G107900g [Phaseolus vulgaris] Length = 268 Score = 100 bits (249), Expect = 1e-22 Identities = 51/78 (65%), Positives = 55/78 (70%), Gaps = 1/78 (1%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXXYMHNVHQQNQ-SLHSIDRSV 443 MEVESEK SDGKVW+FCRMPFWQT H P MHNVHQQNQ +L S+DRS Sbjct: 1 MEVESEKSGSDGKVWSFCRMPFWQTTHTPSSSSSSSSMSYNMHNVHQQNQNNLQSVDRSG 60 Query: 444 PQSSATVSSVAKSLLPTR 497 SS TV SVAKSLLPT+ Sbjct: 61 QHSSTTVLSVAKSLLPTK 78 >ref|XP_016170351.1| vesicle-associated protein 4-2 [Arachis ipaensis] Length = 268 Score = 97.4 bits (241), Expect = 2e-21 Identities = 52/78 (66%), Positives = 54/78 (69%), Gaps = 1/78 (1%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXXYMHNVHQQNQSLHSIDRSVP 446 M VESEK SDGK W+FCRMPFWQT H P YMHNVHQQNQ L S+DRS Sbjct: 1 MAVESEKSGSDGKGWSFCRMPFWQTTHAP-SSSSSSSSTSYMHNVHQQNQGLQSLDRSTQ 59 Query: 447 -QSSATVSSVAKSLLPTR 497 QSS VSSVAKSLLPTR Sbjct: 60 NQSSGMVSSVAKSLLPTR 77 >ref|XP_015936215.1| vesicle-associated protein 4-2 [Arachis duranensis] Length = 268 Score = 97.4 bits (241), Expect = 2e-21 Identities = 52/78 (66%), Positives = 54/78 (69%), Gaps = 1/78 (1%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXXYMHNVHQQNQSLHSIDRSVP 446 M VESEK SDGK W+FCRMPFWQT H P YMHNVHQQNQ L S+DRS Sbjct: 1 MAVESEKSGSDGKGWSFCRMPFWQTTHAP-SSSSSSSSTSYMHNVHQQNQGLQSLDRSTQ 59 Query: 447 -QSSATVSSVAKSLLPTR 497 QSS VSSVAKSLLPTR Sbjct: 60 NQSSGMVSSVAKSLLPTR 77 >gb|KRH26896.1| hypothetical protein GLYMA_12G200900 [Glycine max] Length = 186 Score = 94.4 bits (233), Expect = 4e-21 Identities = 49/78 (62%), Positives = 55/78 (70%), Gaps = 1/78 (1%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXXYMHNVHQQNQ-SLHSIDRSV 443 MEVE+EK SDGK W+FCRMPFWQT H P YMHNVHQQ+Q + S+DRS Sbjct: 1 MEVETEKSGSDGKGWSFCRMPFWQTTHTP-----SSSSMSYMHNVHQQSQNNAQSVDRSS 55 Query: 444 PQSSATVSSVAKSLLPTR 497 SS TVSSVAKSLLPT+ Sbjct: 56 HHSSTTVSSVAKSLLPTK 73 >gb|AFK39696.1| unknown [Lotus japonicus] Length = 266 Score = 95.5 bits (236), Expect = 8e-21 Identities = 50/77 (64%), Positives = 53/77 (68%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXXYMHNVHQQNQSLHSIDRSVP 446 MEVESEKP SD K W+FCRMPFWQTN N YMHN H QN S S+DRS Sbjct: 1 MEVESEKPGSDVKGWSFCRMPFWQTN-NHIPPSSSSSTTSYMHNGHHQNISFQSVDRSTH 59 Query: 447 QSSATVSSVAKSLLPTR 497 Q+S TVSSVAKSLLPTR Sbjct: 60 QASPTVSSVAKSLLPTR 76 >gb|KRH22456.1| hypothetical protein GLYMA_13G301300 [Glycine max] Length = 205 Score = 93.2 bits (230), Expect = 2e-20 Identities = 48/78 (61%), Positives = 54/78 (69%), Gaps = 1/78 (1%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXXYMHNVHQQNQ-SLHSIDRSV 443 MEVE+EK SDGK W+FCRMPFWQT H P YMHNVH QNQ + S+DRS Sbjct: 1 MEVETEKSGSDGKGWSFCRMPFWQTTHTP---SSSTTSMSYMHNVHPQNQNNFQSVDRSS 57 Query: 444 PQSSATVSSVAKSLLPTR 497 SS TVSS+AKSLLPT+ Sbjct: 58 HHSSTTVSSMAKSLLPTK 75 >ref|XP_003540343.1| PREDICTED: vesicle-associated protein 4-2-like [Glycine max] gb|KRH26895.1| hypothetical protein GLYMA_12G200900 [Glycine max] Length = 263 Score = 94.4 bits (233), Expect = 2e-20 Identities = 49/78 (62%), Positives = 55/78 (70%), Gaps = 1/78 (1%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXXYMHNVHQQNQ-SLHSIDRSV 443 MEVE+EK SDGK W+FCRMPFWQT H P YMHNVHQQ+Q + S+DRS Sbjct: 1 MEVETEKSGSDGKGWSFCRMPFWQTTHTP-----SSSSMSYMHNVHQQSQNNAQSVDRSS 55 Query: 444 PQSSATVSSVAKSLLPTR 497 SS TVSSVAKSLLPT+ Sbjct: 56 HHSSTTVSSVAKSLLPTK 73 >gb|KHN04285.1| Vesicle-associated protein 4-2 [Glycine soja] Length = 266 Score = 94.4 bits (233), Expect = 2e-20 Identities = 49/78 (62%), Positives = 55/78 (70%), Gaps = 1/78 (1%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXXYMHNVHQQNQ-SLHSIDRSV 443 MEVE+EK SDGK W+FCRMPFWQT H P YMHNVHQQ+Q + S+DRS Sbjct: 1 MEVETEKSGSDGKGWSFCRMPFWQTTHTP--SSSSSSSMSYMHNVHQQSQNNAQSVDRSS 58 Query: 444 PQSSATVSSVAKSLLPTR 497 SS TVSSVAKSLLPT+ Sbjct: 59 HHSSTTVSSVAKSLLPTK 76 >gb|KHN36606.1| Vesicle-associated protein 4-2 [Glycine soja] Length = 265 Score = 93.2 bits (230), Expect = 6e-20 Identities = 48/78 (61%), Positives = 54/78 (69%), Gaps = 1/78 (1%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXXYMHNVHQQNQ-SLHSIDRSV 443 MEVE+EK SDGK W+FCRMPFWQT H P YMHNVH QNQ + S+DRS Sbjct: 1 MEVETEKSGSDGKGWSFCRMPFWQTTHTP---SSSTTSMSYMHNVHPQNQNNFQSVDRSS 57 Query: 444 PQSSATVSSVAKSLLPTR 497 SS TVSS+AKSLLPT+ Sbjct: 58 HHSSTTVSSMAKSLLPTK 75 >gb|KRH22454.1| hypothetical protein GLYMA_13G301300 [Glycine max] gb|KRH22455.1| hypothetical protein GLYMA_13G301300 [Glycine max] Length = 265 Score = 93.2 bits (230), Expect = 6e-20 Identities = 48/78 (61%), Positives = 54/78 (69%), Gaps = 1/78 (1%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXXYMHNVHQQNQ-SLHSIDRSV 443 MEVE+EK SDGK W+FCRMPFWQT H P YMHNVH QNQ + S+DRS Sbjct: 1 MEVETEKSGSDGKGWSFCRMPFWQTTHTP---SSSTTSMSYMHNVHPQNQNNFQSVDRSS 57 Query: 444 PQSSATVSSVAKSLLPTR 497 SS TVSS+AKSLLPT+ Sbjct: 58 HHSSTTVSSMAKSLLPTK 75 >ref|NP_001241916.1| uncharacterized protein LOC100794120 [Glycine max] gb|ACU19016.1| unknown [Glycine max] Length = 265 Score = 93.2 bits (230), Expect = 6e-20 Identities = 48/78 (61%), Positives = 54/78 (69%), Gaps = 1/78 (1%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXXYMHNVHQQNQ-SLHSIDRSV 443 MEVE+EK SDGK W+FCRMPFWQT H P YMHNVH QNQ + S+DRS Sbjct: 1 MEVETEKSGSDGKGWSFCRMPFWQTTHTP---SSSTTSMSYMHNVHPQNQNNFQSVDRSS 57 Query: 444 PQSSATVSSVAKSLLPTR 497 SS TVSS+AKSLLPT+ Sbjct: 58 HHSSTTVSSMAKSLLPTK 75 >ref|XP_017425857.1| PREDICTED: vesicle-associated protein 4-2-like isoform X2 [Vigna angularis] gb|KOM43922.1| hypothetical protein LR48_Vigan05g152700 [Vigna angularis] Length = 263 Score = 87.0 bits (214), Expect = 1e-17 Identities = 47/77 (61%), Positives = 50/77 (64%) Frame = +3 Query: 267 MEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXXYMHNVHQQNQSLHSIDRSVP 446 MEVESEK S GKVW+FCR PFWQT H P MHN HQ N L S+DRS Sbjct: 1 MEVESEKSGSVGKVWSFCRKPFWQTTHTPSSSSSSTSYN--MHNAHQNN--LQSVDRSGQ 56 Query: 447 QSSATVSSVAKSLLPTR 497 SS TVSSVAKSLLPT+ Sbjct: 57 HSSTTVSSVAKSLLPTK 73 >ref|XP_017425856.1| PREDICTED: vesicle-associated protein 4-1-like isoform X1 [Vigna angularis] dbj|BAT92245.1| hypothetical protein VIGAN_07093000 [Vigna angularis var. angularis] Length = 313 Score = 87.4 bits (215), Expect = 2e-17 Identities = 47/78 (60%), Positives = 51/78 (65%) Frame = +3 Query: 264 KMEVESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXXYMHNVHQQNQSLHSIDRSV 443 +MEVESEK S GKVW+FCR PFWQT H P MHN HQ N L S+DRS Sbjct: 50 EMEVESEKSGSVGKVWSFCRKPFWQTTHTPSSSSSSTSYN--MHNAHQNN--LQSVDRSG 105 Query: 444 PQSSATVSSVAKSLLPTR 497 SS TVSSVAKSLLPT+ Sbjct: 106 QHSSTTVSSVAKSLLPTK 123 >ref|XP_019453744.1| PREDICTED: vesicle-associated protein 4-2-like [Lupinus angustifolius] gb|OIW06042.1| hypothetical protein TanjilG_11729 [Lupinus angustifolius] Length = 268 Score = 86.3 bits (212), Expect = 3e-17 Identities = 45/76 (59%), Positives = 53/76 (69%), Gaps = 1/76 (1%) Frame = +3 Query: 273 VESEKPPSDGKVWNFCRMPFWQTNHNPXXXXXXXXXXXYMH-NVHQQNQSLHSIDRSVPQ 449 VE+EK SDGKVW+FC+MPFW+T H P MH +VHQQ+Q L S+DRS Q Sbjct: 4 VENEKTGSDGKVWSFCKMPFWETTH-PSSSSSTSSTFSSMHSSVHQQSQILQSLDRSTHQ 62 Query: 450 SSATVSSVAKSLLPTR 497 S TVSS+AKSLLPTR Sbjct: 63 PSTTVSSLAKSLLPTR 78