BLASTX nr result
ID: Astragalus23_contig00008936
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00008936 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX90148.1| hypothetical protein L195_g046271, partial [Trifo... 55 1e-06 >gb|PNX90148.1| hypothetical protein L195_g046271, partial [Trifolium pratense] Length = 263 Score = 55.1 bits (131), Expect(2) = 1e-06 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +3 Query: 144 ITEEEVSKYFCTTNHFQTVSSPIANHLE*VEATLTG-EIPTDRAKVFDLK 290 +T+EE+SKYF T +H + VSSPI+N LE V LTG E PTD+A+V L+ Sbjct: 19 LTDEELSKYFSTADHIRIVSSPISNDLERVREGLTGAEFPTDKAQVASLR 68 Score = 24.6 bits (52), Expect(2) = 1e-06 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 287 QASLFKLANVAEIPEVKKNFFHQISL 364 + SLFKLA +IP+ K+ F+ +L Sbjct: 68 RTSLFKLAFSVDIPQPKREVFYWTAL 93